Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5275
Gene name	Serpin family B member 13
Gene symbol	SERPINB13
Synonyms (NCBI Gene)	HSHUR7SEQHUR7PI13headpin
Chromosome	18
Chromosome location	18q21.33
Summary	The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein inhibits the activity of cathepsin K and is itself transcriptionally repressed by RUNX1. This gene is downregulated in many types of cance

Show/Hide all (66)

miRTarBase ID	miRNA	Experiments
MIRT1338640	hsa-miR-129-5p	CLIP-seq
MIRT1338641	hsa-miR-130a	CLIP-seq
MIRT1338642	hsa-miR-130b	CLIP-seq
MIRT1338643	hsa-miR-141	CLIP-seq
MIRT1338644	hsa-miR-200a	CLIP-seq
MIRT1338645	hsa-miR-200b	CLIP-seq
MIRT1338646	hsa-miR-200c	CLIP-seq
MIRT1338647	hsa-miR-301a	CLIP-seq
MIRT1338648	hsa-miR-301b	CLIP-seq
MIRT1338649	hsa-miR-302a	CLIP-seq
MIRT1338650	hsa-miR-302b	CLIP-seq
MIRT1338651	hsa-miR-302c	CLIP-seq
MIRT1338652	hsa-miR-302d	CLIP-seq
MIRT1338653	hsa-miR-302e	CLIP-seq
MIRT1338654	hsa-miR-3125	CLIP-seq
MIRT1338655	hsa-miR-3591-3p	CLIP-seq
MIRT1338656	hsa-miR-3666	CLIP-seq
MIRT1338657	hsa-miR-3688-3p	CLIP-seq
MIRT1338658	hsa-miR-372	CLIP-seq
MIRT1338659	hsa-miR-373	CLIP-seq
MIRT1338660	hsa-miR-3916	CLIP-seq
MIRT1338661	hsa-miR-429	CLIP-seq
MIRT1338662	hsa-miR-4295	CLIP-seq
MIRT1338663	hsa-miR-4434	CLIP-seq
MIRT1338664	hsa-miR-4495	CLIP-seq
MIRT1338665	hsa-miR-4516	CLIP-seq
MIRT1338666	hsa-miR-4531	CLIP-seq
MIRT1338667	hsa-miR-454	CLIP-seq
MIRT1338668	hsa-miR-4639-5p	CLIP-seq
MIRT1338669	hsa-miR-4694-3p	CLIP-seq
MIRT1338670	hsa-miR-4696	CLIP-seq
MIRT1338671	hsa-miR-4703-3p	CLIP-seq
MIRT1338672	hsa-miR-519a	CLIP-seq
MIRT1338673	hsa-miR-519b-3p	CLIP-seq
MIRT1338674	hsa-miR-519c-3p	CLIP-seq
MIRT1338675	hsa-miR-520a-3p	CLIP-seq
MIRT1338676	hsa-miR-520b	CLIP-seq
MIRT1338677	hsa-miR-520c-3p	CLIP-seq
MIRT1338678	hsa-miR-520d-3p	CLIP-seq
MIRT1338679	hsa-miR-520e	CLIP-seq
MIRT1338680	hsa-miR-522	CLIP-seq
MIRT1338681	hsa-miR-548aa	CLIP-seq
MIRT1338682	hsa-miR-587	CLIP-seq
MIRT1338683	hsa-miR-656	CLIP-seq
MIRT1338684	hsa-miR-877	CLIP-seq
MIRT1338657	hsa-miR-3688-3p	CLIP-seq
MIRT2100124	hsa-miR-410	CLIP-seq
MIRT2100125	hsa-miR-4729	CLIP-seq
MIRT1338681	hsa-miR-548aa	CLIP-seq
MIRT2325011	hsa-miR-1292	CLIP-seq
MIRT2325012	hsa-miR-3926	CLIP-seq
MIRT2100124	hsa-miR-410	CLIP-seq
MIRT2325013	hsa-miR-4426	CLIP-seq
MIRT2325014	hsa-miR-4471	CLIP-seq
MIRT2325015	hsa-miR-4647	CLIP-seq
MIRT2325016	hsa-miR-4662b	CLIP-seq
MIRT2325017	hsa-miR-548s	CLIP-seq
MIRT2325018	hsa-miR-582-3p	CLIP-seq
MIRT2394224	hsa-miR-1193	CLIP-seq
MIRT2394225	hsa-miR-151-5p	CLIP-seq
MIRT2394226	hsa-miR-151b	CLIP-seq
MIRT2394227	hsa-miR-2392	CLIP-seq
MIRT2394228	hsa-miR-3131	CLIP-seq
MIRT2394229	hsa-miR-340	CLIP-seq
MIRT2394230	hsa-miR-3605-5p	CLIP-seq
MIRT2394231	hsa-miR-611	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002020	Function	Protease binding	IEA
GO:0002020	Function	Protease binding	IPI	12504904, 12809493
GO:0004866	Function	Endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IDA	12504904
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	NAS	10512713
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IDA	12504904
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IMP	12809493
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005654	Component	Nucleoplasm	IDA	12809493
GO:0005730	Component	Nucleolus	IDA	12809493
GO:0005737	Component	Cytoplasm	IDA	12809493
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0009411	Process	Response to UV	TAS	9297979
GO:0010951	Process	Negative regulation of endopeptidase activity	IDA	12504904
GO:0016607	Component	Nuclear speck	IDA
GO:0030162	Process	Regulation of proteolysis	NAS	10512713
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1902173	Process	Negative regulation of keratinocyte apoptotic process	IMP	12809493

MIM	HGNC	e!Ensembl
604445	8944	ENSG00000197641

Q9UIV8

Protein name

Serpin B13 (HaCaT UV-repressible serpin) (Hurpin) (Headpin) (Peptidase inhibitor 13) (PI-13) (Proteinase inhibitor 13)

Protein function

May play a role in the proliferation or differentiation of keratinocytes.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00079	Serpin	6 → 391	Serpin (serine protease inhibitor)	Domain

Tissue specificity

TISSUE SPECIFICITY: Skin specific.

Sequence

MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSE
KETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKY
LDYVEKYYHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNM
VYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNN
DLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVL
AAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPG
HENVHCNHPFLFFIRHNESNSILFFGRFSSP

Sequence length

391

Interactions

View interactions

	KEGG		Reactome
	Amoebiasis		RUNX1 regulates transcription of genes involved in differentiation of keratinocytes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	35028126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	21723253	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17986283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22032772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19569240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16357159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19569240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19569240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17986283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SERPINB13 (serpin family B member 13)