Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5270
Gene name	Serpin family E member 2
Gene symbol	SERPINE2
Synonyms (NCBI Gene)	GDNGDNPFPI-7PI7PN-1PN1PNI
Chromosome	2
Chromosome location	2q36.1
Summary	This gene encodes a member of the serpin family of proteins, a group of proteins that inhibit serine proteases. Thrombin, urokinase, plasmin and trypsin are among the proteases that this family member can inhibit. This gene is a susceptibility gene for ch

310

Show/Hide all (310)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001419	hsa-miR-16-5p	pSILAC	18668040
MIRT028560	hsa-miR-30a-5p	Proteomics	18668040
MIRT001419	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT044124	hsa-miR-30e-3p	CLASH	23622248
MIRT1338896	hsa-miR-3163	CLIP-seq
MIRT1338897	hsa-miR-410	CLIP-seq
MIRT1338898	hsa-miR-4528	CLIP-seq
MIRT1338899	hsa-miR-586	CLIP-seq
MIRT1553544	hsa-miR-1244	CLIP-seq
MIRT1553545	hsa-miR-1275	CLIP-seq
MIRT1553546	hsa-miR-1299	CLIP-seq
MIRT1553547	hsa-miR-132	CLIP-seq
MIRT1553548	hsa-miR-186	CLIP-seq
MIRT1553549	hsa-miR-194	CLIP-seq
MIRT1553550	hsa-miR-199a-3p	CLIP-seq
MIRT1553551	hsa-miR-199b-3p	CLIP-seq
MIRT1553552	hsa-miR-2052	CLIP-seq
MIRT1553553	hsa-miR-2053	CLIP-seq
MIRT1553554	hsa-miR-212	CLIP-seq
MIRT1553555	hsa-miR-296-3p	CLIP-seq
MIRT1553556	hsa-miR-3065-5p	CLIP-seq
MIRT1553557	hsa-miR-3120-3p	CLIP-seq
MIRT1553558	hsa-miR-3129-5p	CLIP-seq
MIRT1553559	hsa-miR-3133	CLIP-seq
MIRT1553560	hsa-miR-3182	CLIP-seq
MIRT1553561	hsa-miR-3545-3p	CLIP-seq
MIRT1553562	hsa-miR-3591-5p	CLIP-seq
MIRT1553563	hsa-miR-3606	CLIP-seq
MIRT1553564	hsa-miR-3654	CLIP-seq
MIRT1553565	hsa-miR-3920	CLIP-seq
MIRT1553566	hsa-miR-3973	CLIP-seq
MIRT1553567	hsa-miR-3975	CLIP-seq
MIRT1338897	hsa-miR-410	CLIP-seq
MIRT1553568	hsa-miR-4269	CLIP-seq
MIRT1553569	hsa-miR-4326	CLIP-seq
MIRT1553570	hsa-miR-4433	CLIP-seq
MIRT1553571	hsa-miR-4443	CLIP-seq
MIRT1553572	hsa-miR-4511	CLIP-seq
MIRT1553573	hsa-miR-451b	CLIP-seq
MIRT1553574	hsa-miR-4525	CLIP-seq
MIRT1338898	hsa-miR-4528	CLIP-seq
MIRT1553575	hsa-miR-4539	CLIP-seq
MIRT1553576	hsa-miR-4638-3p	CLIP-seq
MIRT1553577	hsa-miR-4652-3p	CLIP-seq
MIRT1553578	hsa-miR-4659a-3p	CLIP-seq
MIRT1553579	hsa-miR-4659b-3p	CLIP-seq
MIRT1553580	hsa-miR-4665-5p	CLIP-seq
MIRT1553581	hsa-miR-4668-5p	CLIP-seq
MIRT1553582	hsa-miR-4696	CLIP-seq
MIRT1553583	hsa-miR-4716-3p	CLIP-seq
MIRT1553584	hsa-miR-4723-5p	CLIP-seq
MIRT1553585	hsa-miR-4766-5p	CLIP-seq
MIRT1553586	hsa-miR-5096	CLIP-seq
MIRT1553587	hsa-miR-513a-3p	CLIP-seq
MIRT1553588	hsa-miR-542-3p	CLIP-seq
MIRT1553589	hsa-miR-545	CLIP-seq
MIRT1553590	hsa-miR-548an	CLIP-seq
MIRT1553591	hsa-miR-548b-3p	CLIP-seq
MIRT1553592	hsa-miR-548p	CLIP-seq
MIRT1553593	hsa-miR-583	CLIP-seq
MIRT1338899	hsa-miR-586	CLIP-seq
MIRT1553594	hsa-miR-590-3p	CLIP-seq
MIRT1553595	hsa-miR-625	CLIP-seq
MIRT1553596	hsa-miR-671-5p	CLIP-seq
MIRT1553597	hsa-miR-875-3p	CLIP-seq
MIRT1553598	hsa-miR-921	CLIP-seq
MIRT1553599	hsa-miR-924	CLIP-seq
MIRT1553600	hsa-miR-936	CLIP-seq
MIRT2433032	hsa-miR-1200	CLIP-seq
MIRT1553544	hsa-miR-1244	CLIP-seq
MIRT1553545	hsa-miR-1275	CLIP-seq
MIRT2433033	hsa-miR-1286	CLIP-seq
MIRT2433034	hsa-miR-1298	CLIP-seq
MIRT1553546	hsa-miR-1299	CLIP-seq
MIRT1553547	hsa-miR-132	CLIP-seq
MIRT1553548	hsa-miR-186	CLIP-seq
MIRT1553549	hsa-miR-194	CLIP-seq
MIRT1553550	hsa-miR-199a-3p	CLIP-seq
MIRT1553551	hsa-miR-199b-3p	CLIP-seq
MIRT1553552	hsa-miR-2052	CLIP-seq
MIRT1553553	hsa-miR-2053	CLIP-seq
MIRT1553554	hsa-miR-212	CLIP-seq
MIRT1553555	hsa-miR-296-3p	CLIP-seq
MIRT1553556	hsa-miR-3065-5p	CLIP-seq
MIRT1553557	hsa-miR-3120-3p	CLIP-seq
MIRT1553558	hsa-miR-3129-5p	CLIP-seq
MIRT1553559	hsa-miR-3133	CLIP-seq
MIRT2433035	hsa-miR-3140-5p	CLIP-seq
MIRT1338896	hsa-miR-3163	CLIP-seq
MIRT1553560	hsa-miR-3182	CLIP-seq
MIRT1553561	hsa-miR-3545-3p	CLIP-seq
MIRT1553565	hsa-miR-3920	CLIP-seq
MIRT1338897	hsa-miR-410	CLIP-seq
MIRT2433036	hsa-miR-421	CLIP-seq
MIRT2433037	hsa-miR-4294	CLIP-seq
MIRT1553569	hsa-miR-4326	CLIP-seq
MIRT1553571	hsa-miR-4443	CLIP-seq
MIRT1553572	hsa-miR-4511	CLIP-seq
MIRT1553573	hsa-miR-451b	CLIP-seq
MIRT1553574	hsa-miR-4525	CLIP-seq
MIRT1338898	hsa-miR-4528	CLIP-seq
MIRT1553575	hsa-miR-4539	CLIP-seq
MIRT1553578	hsa-miR-4659a-3p	CLIP-seq
MIRT1553579	hsa-miR-4659b-3p	CLIP-seq
MIRT1553580	hsa-miR-4665-5p	CLIP-seq
MIRT1553581	hsa-miR-4668-5p	CLIP-seq
MIRT1553582	hsa-miR-4696	CLIP-seq
MIRT2433038	hsa-miR-4709-5p	CLIP-seq
MIRT1553583	hsa-miR-4716-3p	CLIP-seq
MIRT2433039	hsa-miR-4722-5p	CLIP-seq
MIRT1553584	hsa-miR-4723-5p	CLIP-seq
MIRT1553585	hsa-miR-4766-5p	CLIP-seq
MIRT2433040	hsa-miR-4775	CLIP-seq
MIRT1553587	hsa-miR-513a-3p	CLIP-seq
MIRT1553590	hsa-miR-548an	CLIP-seq
MIRT1553591	hsa-miR-548b-3p	CLIP-seq
MIRT1338899	hsa-miR-586	CLIP-seq
MIRT1553594	hsa-miR-590-3p	CLIP-seq
MIRT1553595	hsa-miR-625	CLIP-seq
MIRT2433041	hsa-miR-664	CLIP-seq
MIRT1553596	hsa-miR-671-5p	CLIP-seq
MIRT1553597	hsa-miR-875-3p	CLIP-seq
MIRT2433042	hsa-miR-888	CLIP-seq
MIRT1553599	hsa-miR-924	CLIP-seq
MIRT1553600	hsa-miR-936	CLIP-seq
MIRT1553544	hsa-miR-1244	CLIP-seq
MIRT2433034	hsa-miR-1298	CLIP-seq
MIRT1553546	hsa-miR-1299	CLIP-seq
MIRT1553547	hsa-miR-132	CLIP-seq
MIRT2440156	hsa-miR-1470	CLIP-seq
MIRT1553548	hsa-miR-186	CLIP-seq
MIRT1553549	hsa-miR-194	CLIP-seq
MIRT1553550	hsa-miR-199a-3p	CLIP-seq
MIRT1553551	hsa-miR-199b-3p	CLIP-seq
MIRT1553553	hsa-miR-2053	CLIP-seq
MIRT1553554	hsa-miR-212	CLIP-seq
MIRT1553555	hsa-miR-296-3p	CLIP-seq
MIRT1553557	hsa-miR-3120-3p	CLIP-seq
MIRT1553558	hsa-miR-3129-5p	CLIP-seq
MIRT1553559	hsa-miR-3133	CLIP-seq
MIRT1338896	hsa-miR-3163	CLIP-seq
MIRT1553560	hsa-miR-3182	CLIP-seq
MIRT2440157	hsa-miR-323b-3p	CLIP-seq
MIRT1553562	hsa-miR-3591-5p	CLIP-seq
MIRT1553563	hsa-miR-3606	CLIP-seq
MIRT2440158	hsa-miR-370	CLIP-seq
MIRT1553565	hsa-miR-3920	CLIP-seq
MIRT1338897	hsa-miR-410	CLIP-seq
MIRT2433036	hsa-miR-421	CLIP-seq
MIRT2440159	hsa-miR-4255	CLIP-seq
MIRT1553569	hsa-miR-4326	CLIP-seq
MIRT1553570	hsa-miR-4433	CLIP-seq
MIRT2440160	hsa-miR-4446-5p	CLIP-seq
MIRT1553572	hsa-miR-4511	CLIP-seq
MIRT1553573	hsa-miR-451b	CLIP-seq
MIRT1338898	hsa-miR-4528	CLIP-seq
MIRT1553578	hsa-miR-4659a-3p	CLIP-seq
MIRT1553579	hsa-miR-4659b-3p	CLIP-seq
MIRT2440161	hsa-miR-4667-3p	CLIP-seq
MIRT1553582	hsa-miR-4696	CLIP-seq
MIRT2433038	hsa-miR-4709-5p	CLIP-seq
MIRT2440162	hsa-miR-4755-5p	CLIP-seq
MIRT1553585	hsa-miR-4766-5p	CLIP-seq
MIRT2440163	hsa-miR-4773	CLIP-seq
MIRT2440164	hsa-miR-4793-5p	CLIP-seq
MIRT2440165	hsa-miR-4797-3p	CLIP-seq
MIRT1553587	hsa-miR-513a-3p	CLIP-seq
MIRT1553591	hsa-miR-548b-3p	CLIP-seq
MIRT1338899	hsa-miR-586	CLIP-seq
MIRT1553594	hsa-miR-590-3p	CLIP-seq
MIRT2440166	hsa-miR-642a	CLIP-seq
MIRT2433041	hsa-miR-664	CLIP-seq
MIRT1553596	hsa-miR-671-5p	CLIP-seq
MIRT1553597	hsa-miR-875-3p	CLIP-seq
MIRT2440167	hsa-miR-875-5p	CLIP-seq
MIRT1553598	hsa-miR-921	CLIP-seq
MIRT1553600	hsa-miR-936	CLIP-seq
MIRT1553557	hsa-miR-3120-3p	CLIP-seq
MIRT1553560	hsa-miR-3182	CLIP-seq
MIRT1553565	hsa-miR-3920	CLIP-seq
MIRT1553570	hsa-miR-4433	CLIP-seq
MIRT1553573	hsa-miR-451b	CLIP-seq
MIRT1553578	hsa-miR-4659a-3p	CLIP-seq
MIRT1553579	hsa-miR-4659b-3p	CLIP-seq
MIRT1553582	hsa-miR-4696	CLIP-seq
MIRT1553585	hsa-miR-4766-5p	CLIP-seq
MIRT1553587	hsa-miR-513a-3p	CLIP-seq
MIRT2433032	hsa-miR-1200	CLIP-seq
MIRT1553544	hsa-miR-1244	CLIP-seq
MIRT2433034	hsa-miR-1298	CLIP-seq
MIRT1553546	hsa-miR-1299	CLIP-seq
MIRT1553547	hsa-miR-132	CLIP-seq
MIRT1553548	hsa-miR-186	CLIP-seq
MIRT1553549	hsa-miR-194	CLIP-seq
MIRT1553550	hsa-miR-199a-3p	CLIP-seq
MIRT1553551	hsa-miR-199b-3p	CLIP-seq
MIRT1553552	hsa-miR-2052	CLIP-seq
MIRT1553553	hsa-miR-2053	CLIP-seq
MIRT1553554	hsa-miR-212	CLIP-seq
MIRT1553555	hsa-miR-296-3p	CLIP-seq
MIRT1553556	hsa-miR-3065-5p	CLIP-seq
MIRT1553557	hsa-miR-3120-3p	CLIP-seq
MIRT1553558	hsa-miR-3129-5p	CLIP-seq
MIRT1553559	hsa-miR-3133	CLIP-seq
MIRT2433035	hsa-miR-3140-5p	CLIP-seq
MIRT1338896	hsa-miR-3163	CLIP-seq
MIRT1553560	hsa-miR-3182	CLIP-seq
MIRT1553561	hsa-miR-3545-3p	CLIP-seq
MIRT1553562	hsa-miR-3591-5p	CLIP-seq
MIRT1553563	hsa-miR-3606	CLIP-seq
MIRT1553564	hsa-miR-3654	CLIP-seq
MIRT1553565	hsa-miR-3920	CLIP-seq
MIRT1553567	hsa-miR-3975	CLIP-seq
MIRT1338897	hsa-miR-410	CLIP-seq
MIRT2433036	hsa-miR-421	CLIP-seq
MIRT2440159	hsa-miR-4255	CLIP-seq
MIRT1553569	hsa-miR-4326	CLIP-seq
MIRT1553570	hsa-miR-4433	CLIP-seq
MIRT1553572	hsa-miR-4511	CLIP-seq
MIRT1553573	hsa-miR-451b	CLIP-seq
MIRT1338898	hsa-miR-4528	CLIP-seq
MIRT1553575	hsa-miR-4539	CLIP-seq
MIRT1553576	hsa-miR-4638-3p	CLIP-seq
MIRT1553578	hsa-miR-4659a-3p	CLIP-seq
MIRT1553579	hsa-miR-4659b-3p	CLIP-seq
MIRT1553582	hsa-miR-4696	CLIP-seq
MIRT2433038	hsa-miR-4709-5p	CLIP-seq
MIRT1553585	hsa-miR-4766-5p	CLIP-seq
MIRT2440165	hsa-miR-4797-3p	CLIP-seq
MIRT1553586	hsa-miR-5096	CLIP-seq
MIRT1553587	hsa-miR-513a-3p	CLIP-seq
MIRT1553589	hsa-miR-545	CLIP-seq
MIRT1553591	hsa-miR-548b-3p	CLIP-seq
MIRT1553593	hsa-miR-583	CLIP-seq
MIRT1338899	hsa-miR-586	CLIP-seq
MIRT1553594	hsa-miR-590-3p	CLIP-seq
MIRT2433041	hsa-miR-664	CLIP-seq
MIRT1553596	hsa-miR-671-5p	CLIP-seq
MIRT1553597	hsa-miR-875-3p	CLIP-seq
MIRT2433042	hsa-miR-888	CLIP-seq
MIRT1553598	hsa-miR-921	CLIP-seq
MIRT1553600	hsa-miR-936	CLIP-seq
MIRT2433032	hsa-miR-1200	CLIP-seq
MIRT1553544	hsa-miR-1244	CLIP-seq
MIRT1553545	hsa-miR-1275	CLIP-seq
MIRT2433034	hsa-miR-1298	CLIP-seq
MIRT1553546	hsa-miR-1299	CLIP-seq
MIRT1553547	hsa-miR-132	CLIP-seq
MIRT2440156	hsa-miR-1470	CLIP-seq
MIRT1553548	hsa-miR-186	CLIP-seq
MIRT1553549	hsa-miR-194	CLIP-seq
MIRT1553550	hsa-miR-199a-3p	CLIP-seq
MIRT1553551	hsa-miR-199b-3p	CLIP-seq
MIRT1553553	hsa-miR-2053	CLIP-seq
MIRT1553554	hsa-miR-212	CLIP-seq
MIRT1553555	hsa-miR-296-3p	CLIP-seq
MIRT1553556	hsa-miR-3065-5p	CLIP-seq
MIRT1553557	hsa-miR-3120-3p	CLIP-seq
MIRT1553558	hsa-miR-3129-5p	CLIP-seq
MIRT1553559	hsa-miR-3133	CLIP-seq
MIRT2433035	hsa-miR-3140-5p	CLIP-seq
MIRT1338896	hsa-miR-3163	CLIP-seq
MIRT1553560	hsa-miR-3182	CLIP-seq
MIRT2440157	hsa-miR-323b-3p	CLIP-seq
MIRT1553561	hsa-miR-3545-3p	CLIP-seq
MIRT1553562	hsa-miR-3591-5p	CLIP-seq
MIRT1553563	hsa-miR-3606	CLIP-seq
MIRT1553564	hsa-miR-3654	CLIP-seq
MIRT2440158	hsa-miR-370	CLIP-seq
MIRT1553565	hsa-miR-3920	CLIP-seq
MIRT1553567	hsa-miR-3975	CLIP-seq
MIRT1338897	hsa-miR-410	CLIP-seq
MIRT2433036	hsa-miR-421	CLIP-seq
MIRT2440159	hsa-miR-4255	CLIP-seq
MIRT1553569	hsa-miR-4326	CLIP-seq
MIRT1553570	hsa-miR-4433	CLIP-seq
MIRT1553571	hsa-miR-4443	CLIP-seq
MIRT2440160	hsa-miR-4446-5p	CLIP-seq
MIRT1553573	hsa-miR-451b	CLIP-seq
MIRT1553574	hsa-miR-4525	CLIP-seq
MIRT1338898	hsa-miR-4528	CLIP-seq
MIRT1553575	hsa-miR-4539	CLIP-seq
MIRT1553576	hsa-miR-4638-3p	CLIP-seq
MIRT1553578	hsa-miR-4659a-3p	CLIP-seq
MIRT1553579	hsa-miR-4659b-3p	CLIP-seq
MIRT1553580	hsa-miR-4665-5p	CLIP-seq
MIRT2440161	hsa-miR-4667-3p	CLIP-seq
MIRT1553582	hsa-miR-4696	CLIP-seq
MIRT2433038	hsa-miR-4709-5p	CLIP-seq
MIRT1553583	hsa-miR-4716-3p	CLIP-seq
MIRT1553584	hsa-miR-4723-5p	CLIP-seq
MIRT2440162	hsa-miR-4755-5p	CLIP-seq
MIRT1553585	hsa-miR-4766-5p	CLIP-seq
MIRT2440164	hsa-miR-4793-5p	CLIP-seq
MIRT2440165	hsa-miR-4797-3p	CLIP-seq
MIRT1553586	hsa-miR-5096	CLIP-seq
MIRT1553587	hsa-miR-513a-3p	CLIP-seq
MIRT1553589	hsa-miR-545	CLIP-seq
MIRT1553593	hsa-miR-583	CLIP-seq
MIRT1338899	hsa-miR-586	CLIP-seq
MIRT1553594	hsa-miR-590-3p	CLIP-seq
MIRT1553595	hsa-miR-625	CLIP-seq
MIRT2440166	hsa-miR-642a	CLIP-seq
MIRT2433041	hsa-miR-664	CLIP-seq
MIRT1553596	hsa-miR-671-5p	CLIP-seq
MIRT1553597	hsa-miR-875-3p	CLIP-seq
MIRT2440167	hsa-miR-875-5p	CLIP-seq
MIRT2433042	hsa-miR-888	CLIP-seq
MIRT1553598	hsa-miR-921	CLIP-seq
MIRT1553600	hsa-miR-936	CLIP-seq

Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IDA	3997857, 19249338, 19855083
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IMP	19855083
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	17379830
GO:0005515	Function	Protein binding	IPI	3279057, 19911255, 25416956
GO:0005539	Function	Glycosaminoglycan binding	IDA	19855083
GO:0005576	Component	Extracellular region	IDA	3997857, 19855083
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005829	Component	Cytosol	IDA	19855083
GO:0007399	Process	Nervous system development	IEA
GO:0007596	Process	Blood coagulation	IEA
GO:0008201	Function	Heparin binding	IDA	1939253, 3997857
GO:0008201	Function	Heparin binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009611	Process	Response to wounding	IEA
GO:0010544	Process	Negative regulation of platelet activation	IEA
GO:0010757	Process	Negative regulation of plasminogen activation	IBA
GO:0010757	Process	Negative regulation of plasminogen activation	IEA
GO:0010757	Process	Negative regulation of plasminogen activation	IMP	19855083
GO:0010766	Process	Negative regulation of sodium ion transport	IEA
GO:0010955	Process	Negative regulation of protein processing	IC	19855083
GO:0021683	Process	Cerebellar granular layer morphogenesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030163	Process	Protein catabolic process	IEA
GO:0030168	Process	Platelet activation	IEA
GO:0030195	Process	Negative regulation of blood coagulation	IC	19855083
GO:0030195	Process	Negative regulation of blood coagulation	IDA	17379830
GO:0030195	Process	Negative regulation of blood coagulation	IEA
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0030334	Process	Regulation of cell migration	NAS	2877744
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	IDA	3279057
GO:0031091	Component	Platelet alpha granule	IDA	19855083
GO:0031091	Component	Platelet alpha granule	IMP	19855083
GO:0031594	Component	Neuromuscular junction	IEA
GO:0031594	Component	Neuromuscular junction	ISS	2037625
GO:0032940	Process	Secretion by cell	IEA
GO:0033363	Process	Secretory granule organization	IEA
GO:0042177	Process	Negative regulation of protein catabolic process	IEA
GO:0042628	Process	Mating plug formation	IEA
GO:0045861	Process	Negative regulation of proteolysis	IDA	3997857, 17379830
GO:0045861	Process	Negative regulation of proteolysis	IEA
GO:0045879	Process	Negative regulation of smoothened signaling pathway	IEA
GO:0048505	Process	Regulation of timing of cell differentiation	IEA
GO:0048711	Process	Positive regulation of astrocyte differentiation	IDA	1691280
GO:0050974	Process	Detection of mechanical stimulus involved in sensory perception	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	IEA
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0060384	Process	Innervation	IEA
GO:0061108	Process	Seminal vesicle epithelium development	IEA
GO:0090331	Process	Negative regulation of platelet aggregation	IEA
GO:0090331	Process	Negative regulation of platelet aggregation	ISS	19855083
GO:1903561	Component	Extracellular vesicle	HDA	24769233

MIM	HGNC	e!Ensembl
177010	8951	ENSG00000135919

P07093

Protein name

Glia-derived nexin (GDN) (Peptidase inhibitor 7) (PI-7) (Protease nexin 1) (PN-1) (Protease nexin I) (Serpin E2)

Protein function

Serine protease inhibitor with activity toward thrombin, trypsin, and urokinase. Promotes neurite extension by inhibiting thrombin. Binds heparin.

PDB

4DY0 , 4DY7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00079	Serpin	31 → 398	Serpin (serine protease inhibitor)	Domain

Sequence

MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIAS
VLGMLQLGADGRTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNAS
EIEVPFVTRNKDVFQCEVRNVNFEDPASACDSINAWVKNETRDMIDNLLSPDLIDGVLTR
LVLVNAVYFKGLWKSRFQPENTKKRTFVAADGKSYQVPMLAQLSVFRCGSTSAPNDLWYN
FIELPYHGESISMLIALPTESSTPLSAIIPHISTKTIDSWMSIMVPKRVQVILPKFTAVA
QTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSEDGTKASAATTA
ILIARSSPPWFIVDRPFLFFIRHNPTGAVLFMGQINKP

Sequence length

398

Interactions

View interactions

	KEGG		Reactome
	Complement and coagulation cascades		Intrinsic Pathway of Fibrin Clot Formation Common Pathway of Fibrin Clot Formation Dissolution of Fibrin Clot

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (83)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	29556291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	23041623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	20942929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Thoracic	Aortic Aneurysm	BEFREE	23814118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21436250, 30206357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	21436250, 30206357	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11156382, 11814314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	11939722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	28677735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19584287, 27793045, 31501409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28453461, 33317533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36646679	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	19626039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	LHGDN	12859287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	21436250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	16358219, 17446335, 18550614, 19604412, 19949669, 20298363, 21067581, 21611750, 22028159, 22145704, 26214473, 31215134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20942929, 27600906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19555470	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	20942929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31679650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	31679650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31679650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	31679650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	18310226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26305372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31679650, 35948367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31679650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	28677735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	28677735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	21067581, 22145704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28453461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36011368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	1987320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	39938577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	1987320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	35942730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	18421023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	31383642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	31383642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	36505099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	31091022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19017876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	25199049	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28644887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	27460424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	27460424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	20623540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34648881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19584287, 27793045, 31501409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25359682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25359682, 28255192, 31735169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	28549896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19584287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12941819, 17468036, 19584287, 20942929, 23041623, 27600906, 27793045, 29556291, 29716922, 30102804, 30409320, 30813165, 31165486, 31583542, 31698006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1987320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	11925594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28125591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	25853553	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33094798	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	Pubtator	24336069	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27221371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	12941819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28255192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	25686839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19017876, 19949669, 20525719, 21067581, 21401569, 21436250, 22028159, 22145704, 22976395, 27193053, 32099002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23886569	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	21067581, 22145704, 25517131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30254103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	10207170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17468036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31730904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26318431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	31704557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27847115, 30409320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25359682, 31199037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25400735, 31199037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	10207170, 11876527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28255192	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28255192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29270654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	40481075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	37537391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SERPINE2 (serpin family E member 2)