SLC25A3 (solute carrier family 25 member 3)

Gene

• Entrez ID: 5250
• Gene name: Solute carrier family 25 member 3
• Gene symbol: SLC25A3
• Synonyms (NCBI Gene): OK/SW-cl.48, PHC, PTP, PiC
• Chromosome: 12
• Chromosome location: 12q23.1
• Summary: The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those f

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs104894375	G>A	Pathogenic	Coding sequence variant, intron variant, missense variant
rs745305932	A>G	Pathogenic-likely-pathogenic	Intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050860	hsa-miR-17-5p	CLASH	23622248
MIRT048927	hsa-miR-92a-3p	CLASH	23622248
MIRT048032	hsa-miR-148a-3p	CLASH	23622248
MIRT043170	hsa-miR-324-5p	CLASH	23622248
MIRT039345	hsa-miR-425-5p	CLASH	23622248
MIRT037487	hsa-miR-744-5p	CLASH	23622248
MIRT037487	hsa-miR-744-5p	CLASH	23622248
MIRT037303	hsa-miR-877-5p	CLASH	23622248
MIRT052685	hsa-miR-1260b	CLASH	23622248
MIRT052685	hsa-miR-1260b	CLASH	23622248
MIRT1356365	hsa-miR-3074-3p	CLIP-seq
MIRT1356366	hsa-miR-873	CLIP-seq
MIRT2105541	hsa-miR-141	CLIP-seq
MIRT2105542	hsa-miR-1910	CLIP-seq
MIRT2105543	hsa-miR-200a	CLIP-seq
MIRT2105544	hsa-miR-224	CLIP-seq
MIRT2105545	hsa-miR-3065-5p	CLIP-seq
MIRT2105546	hsa-miR-3163	CLIP-seq
MIRT2105547	hsa-miR-3671	CLIP-seq
MIRT2105548	hsa-miR-3685	CLIP-seq
MIRT2105549	hsa-miR-384	CLIP-seq
MIRT2105550	hsa-miR-410	CLIP-seq
MIRT2105551	hsa-miR-421	CLIP-seq
MIRT2105552	hsa-miR-4325	CLIP-seq
MIRT2105553	hsa-miR-450b-5p	CLIP-seq
MIRT2105554	hsa-miR-455-3p	CLIP-seq
MIRT2105555	hsa-miR-4659a-3p	CLIP-seq
MIRT2105556	hsa-miR-4659b-3p	CLIP-seq
MIRT2105557	hsa-miR-4742-5p	CLIP-seq
MIRT2105558	hsa-miR-507	CLIP-seq
MIRT2105559	hsa-miR-513a-5p	CLIP-seq
MIRT2105560	hsa-miR-548c-3p	CLIP-seq
MIRT2105561	hsa-miR-557	CLIP-seq
MIRT2105541	hsa-miR-141	CLIP-seq
MIRT2105542	hsa-miR-1910	CLIP-seq
MIRT2105543	hsa-miR-200a	CLIP-seq
MIRT2105545	hsa-miR-3065-5p	CLIP-seq
MIRT2330046	hsa-miR-3940-5p	CLIP-seq
MIRT2105551	hsa-miR-421	CLIP-seq
MIRT2330047	hsa-miR-4259	CLIP-seq
MIRT2105552	hsa-miR-4325	CLIP-seq
MIRT2330048	hsa-miR-4507	CLIP-seq
MIRT2105553	hsa-miR-450b-5p	CLIP-seq
MIRT2105554	hsa-miR-455-3p	CLIP-seq
MIRT2105555	hsa-miR-4659a-3p	CLIP-seq
MIRT2105556	hsa-miR-4659b-3p	CLIP-seq
MIRT2105558	hsa-miR-507	CLIP-seq
MIRT2105561	hsa-miR-557	CLIP-seq
MIRT2330049	hsa-miR-571	CLIP-seq
MIRT2330050	hsa-miR-629	CLIP-seq
MIRT2105541	hsa-miR-141	CLIP-seq
MIRT2105543	hsa-miR-200a	CLIP-seq
MIRT2105551	hsa-miR-421	CLIP-seq
MIRT2105552	hsa-miR-4325	CLIP-seq
MIRT2105555	hsa-miR-4659a-3p	CLIP-seq
MIRT2105556	hsa-miR-4659b-3p	CLIP-seq
MIRT2105558	hsa-miR-507	CLIP-seq
MIRT2105561	hsa-miR-557	CLIP-seq
MIRT2433228	hsa-miR-4503	CLIP-seq
MIRT2433229	hsa-miR-451b	CLIP-seq
MIRT2433230	hsa-miR-4738-3p	CLIP-seq
MIRT2624219	hsa-miR-101	CLIP-seq
MIRT2624220	hsa-miR-139-5p	CLIP-seq
MIRT2105541	hsa-miR-141	CLIP-seq
MIRT2624221	hsa-miR-144	CLIP-seq
MIRT2105542	hsa-miR-1910	CLIP-seq
MIRT2105543	hsa-miR-200a	CLIP-seq
MIRT2105545	hsa-miR-3065-5p	CLIP-seq
MIRT1356365	hsa-miR-3074-3p	CLIP-seq
MIRT2105546	hsa-miR-3163	CLIP-seq
MIRT2105547	hsa-miR-3671	CLIP-seq
MIRT2105548	hsa-miR-3685	CLIP-seq
MIRT2105549	hsa-miR-384	CLIP-seq
MIRT2105550	hsa-miR-410	CLIP-seq
MIRT2105551	hsa-miR-421	CLIP-seq
MIRT2105552	hsa-miR-4325	CLIP-seq
MIRT2433228	hsa-miR-4503	CLIP-seq
MIRT2105553	hsa-miR-450b-5p	CLIP-seq
MIRT2433229	hsa-miR-451b	CLIP-seq
MIRT2105554	hsa-miR-455-3p	CLIP-seq
MIRT2105555	hsa-miR-4659a-3p	CLIP-seq
MIRT2105556	hsa-miR-4659b-3p	CLIP-seq
MIRT2433230	hsa-miR-4738-3p	CLIP-seq
MIRT2105558	hsa-miR-507	CLIP-seq
MIRT2624222	hsa-miR-548n	CLIP-seq
MIRT2624223	hsa-miR-548t	CLIP-seq
MIRT2105561	hsa-miR-557	CLIP-seq
MIRT1356366	hsa-miR-873	CLIP-seq
MIRT2624224	hsa-miR-944	CLIP-seq
MIRT2624219	hsa-miR-101	CLIP-seq
MIRT2624220	hsa-miR-139-5p	CLIP-seq
MIRT2105541	hsa-miR-141	CLIP-seq
MIRT2624221	hsa-miR-144	CLIP-seq
MIRT2105542	hsa-miR-1910	CLIP-seq
MIRT2105543	hsa-miR-200a	CLIP-seq
MIRT2105545	hsa-miR-3065-5p	CLIP-seq
MIRT1356365	hsa-miR-3074-3p	CLIP-seq
MIRT2105546	hsa-miR-3163	CLIP-seq
MIRT2105547	hsa-miR-3671	CLIP-seq
MIRT2105548	hsa-miR-3685	CLIP-seq
MIRT2105549	hsa-miR-384	CLIP-seq
MIRT2105550	hsa-miR-410	CLIP-seq
MIRT2105551	hsa-miR-421	CLIP-seq
MIRT2105552	hsa-miR-4325	CLIP-seq
MIRT2433228	hsa-miR-4503	CLIP-seq
MIRT2105553	hsa-miR-450b-5p	CLIP-seq
MIRT2433229	hsa-miR-451b	CLIP-seq
MIRT2105554	hsa-miR-455-3p	CLIP-seq
MIRT2105555	hsa-miR-4659a-3p	CLIP-seq
MIRT2105556	hsa-miR-4659b-3p	CLIP-seq
MIRT2433230	hsa-miR-4738-3p	CLIP-seq
MIRT2105558	hsa-miR-507	CLIP-seq
MIRT2624222	hsa-miR-548n	CLIP-seq
MIRT2624223	hsa-miR-548t	CLIP-seq
MIRT2105561	hsa-miR-557	CLIP-seq
MIRT1356366	hsa-miR-873	CLIP-seq
MIRT2624224	hsa-miR-944	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005315	Function	Phosphate transmembrane transporter activity	IBA
GO:0005315	Function	Phosphate transmembrane transporter activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	8168843
GO:0005743	Component	Mitochondrial inner membrane	IBA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	ISS
GO:0005743	Component	Mitochondrial inner membrane	TAS	8144629
GO:0005886	Component	Plasma membrane	TAS	8144629
GO:0015293	Function	Symporter activity	IEA
GO:0015317	Function	Phosphate:proton symporter activity	ISS
GO:0015317	Function	Phosphate:proton symporter activity	TAS	8144629
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0035435	Process	Phosphate ion transmembrane transport	IBA
GO:0044877	Function	Protein-containing complex binding	IDA	23209302
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1990547	Process	Mitochondrial phosphate ion transmembrane transport	IEA

Other IDs

• MIM: 600370
• HGNC: 10989
• e!Ensembl: ENSG00000075415

Protein

• UniProt ID: Q00325
• Protein name: Solute carrier family 25 member 3 (Phosphate carrier protein, mitochondrial) (Phosphate transport protein) (PTP)
• Protein function: Inorganic ion transporter that transports phosphate or copper ions across the mitochondrial inner membrane into the matrix compartment (By similarity) (PubMed:17273968, PubMed:29237729). Mediates proton-coupled symport of phosphate ions necessar
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00153	Mito_carr	63 → 152	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	161 → 249	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	259 → 343	Mitochondrial carrier protein	Family

• Sequence:

  MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYG
  SGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLA
  KGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIAL
  APMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFER
  TVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSAS
  LVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGL
  TQ

• Sequence length: 362

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Cardiomyopathy-hypotonia-lactic acidosis syndrome	Likely pathogenic; Pathogenic	rs745305932, rs104894375, rs2097597579, rs2097595072	RCV001255139 RCV000009720 RCV001255138 RCV001255140	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY WITH HYPOTONIA AND LACTIC ACIDOSIS SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASE	—	CTD, ClinGen	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC25A3-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acidosis Lactic	Lactic acidosis	Pubtator	17273968, 39671292	Associate	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	10769629, 25730908		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	10657947		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28758731		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	22505657		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31616406		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26817397		★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	19654405	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	19654405		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10365916, 10769629, 18183590		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	30126387		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	1596910, 1711217		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28923567		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	39671292	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	24658400		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	17273968, 39671292	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy-hypotonia-lactic acidosis syndrome	Cardiomyopathy-Hypotonia-Lactic Acidosis Syndrome	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31319588		★☆☆☆☆ Found in Text Mining only
Chloasma	Melasma	BEFREE	31516612		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	7585599		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18183590		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20477815, 24242166, 30731403		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	19000305		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35924107	Inhibit	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	1711217, 8833149		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	9862731		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29163359, 9862731		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15571930, 8798755, 9754810, 9862731		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16679294, 29439147		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	22482891		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	22482891		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30348936		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22505657, 30348936		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20506511, 22505657		★☆☆☆☆ Found in Text Mining only
Hermaphroditism	Hermaphroditism	BEFREE	28065609		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	16679294		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15229188, 28692753, 30566464		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	LHGDN	17273968		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	39671292	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24385580		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30947811		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	10769629, 7585599		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23825065		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26308771		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31145771		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29558404		★☆☆☆☆ Found in Text Mining only
Low-output congestive heart failure	Congestive Heart Failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	1711217		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31616406		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10365916, 10769629, 18183590		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	1596910		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	1596910		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31145771		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28923567		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27762495, 30172243		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20477815		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10769629, 12553013, 19000305, 22099875, 28586036, 29214238, 30297534, 31805633		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18183590		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11710941, 15888148		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	29860958		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	17273968, 33615715, 39671292	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Phosphate Carrier Deficiency	Mitochondrial Phosphate Carrier Deficiency	ORPHANET_DG	17273968		★☆☆☆☆ Found in Text Mining only
Mitochondrial Phosphate Carrier Deficiency	Mitochondrial Phosphate Carrier Deficiency	UNIPROT_DG	17273968		★☆☆☆☆ Found in Text Mining only
Mitochondrial Phosphate Carrier Deficiency	Mitochondrial Phosphate Carrier Deficiency	GENOMICS_ENGLAND_DG	25681081, 27604308		★☆☆☆☆ Found in Text Mining only
Mitochondrial Phosphate Carrier Deficiency	Mitochondrial Phosphate Carrier Deficiency	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Mitochondrial Phosphate Carrier Deficiency	Mitochondrial Phosphate Carrier Deficiency	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	19654405, 29507701		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10769629, 11597125, 1596910, 16682945, 1711217, 28586036, 28923567, 29558404, 30297534, 31213912, 8833149		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30315478		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	10657947		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	BEFREE	15834506, 23825065, 27939989, 29214238		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15229188		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	8992885		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28923567		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27762495, 30172243		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	26825389		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	10657947		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	12920026		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	26817397		★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	30921411		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	1711217, 8833149		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	30947811		★☆☆☆☆ Found in Text Mining only
Stage IV Skin Melanoma	Skin Melanoma	BEFREE	25113440		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	26746987		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	39671292	Associate	★☆☆☆☆ Found in Text Mining only
X-linked centronuclear myopathy	Centronuclear Myopathy, X-Linked	BEFREE	30884204		★☆☆☆☆ Found in Text Mining only