PHB1 (prohibitin 1)

Gene

• Entrez ID: 5245
• Gene name: Prohibitin 1
• Gene symbol: PHB1
• Synonyms (NCBI Gene): BAP32, HEL-215, HEL-S-54e, PHB
• Chromosome: 17
• Chromosome location: 17q21.33

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs112294663	G>A,C,T	Risk-factor	3 prime UTR variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001210	hsa-miR-27a-3p	qRT-PCR, GFP reporter assay, Western blot	18789835
MIRT001210	hsa-miR-27a-3p	qRT-PCR, GFP reporter assay, Western blot	18789835
MIRT001210	hsa-miR-27a-3p	ChIP-seq, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	22505583
MIRT001210	hsa-miR-27a-3p	ChIP-seq, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	22505583
MIRT001210	hsa-miR-27a-3p	ChIP-seq, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	22505583
MIRT001210	hsa-miR-27a-3p	ChIP-seq, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	22505583
MIRT001210	hsa-miR-27a-3p	ChIP-seq, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	22505583
MIRT001210	hsa-miR-27a-3p	ChIP-seq, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	22505583
MIRT041678	hsa-miR-484	CLASH	23622248
MIRT438656	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23870455
MIRT438656	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23870455
MIRT001210	hsa-miR-27a-3p	Luciferase reporter assay	24133204
MIRT001210	hsa-miR-27a-3p	Luciferase reporter assay	24133204
MIRT438627	hsa-miR-27b-3p	Luciferase reporter assay	24133204
MIRT438627	hsa-miR-27b-3p	Luciferase reporter assay	24133204
MIRT438656	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23870455
MIRT438656	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23870455
MIRT001210	hsa-miR-27a-3p	Luciferase reporter assay	24133204
MIRT001210	hsa-miR-27a-3p	Luciferase reporter assay	24133204
MIRT438627	hsa-miR-27b-3p	Luciferase reporter assay	24133204
MIRT438627	hsa-miR-27b-3p	Luciferase reporter assay	24133204
MIRT001210	hsa-miR-27a-3p	Luciferase reporter assay, Microarray, qRT-PCR	25915942
MIRT001210	hsa-miR-27a-3p	Luciferase reporter assay	25777779
MIRT1229383	hsa-miR-1252	CLIP-seq
MIRT1229384	hsa-miR-1264	CLIP-seq
MIRT1229385	hsa-miR-128	CLIP-seq
MIRT1229386	hsa-miR-1284	CLIP-seq
MIRT1229387	hsa-miR-205	CLIP-seq
MIRT1229388	hsa-miR-2277-3p	CLIP-seq
MIRT1229389	hsa-miR-27a	CLIP-seq
MIRT1229390	hsa-miR-27b	CLIP-seq
MIRT1229391	hsa-miR-298	CLIP-seq
MIRT1229392	hsa-miR-300	CLIP-seq
MIRT1229393	hsa-miR-3125	CLIP-seq
MIRT1229394	hsa-miR-3126-5p	CLIP-seq
MIRT1229395	hsa-miR-3132	CLIP-seq
MIRT1229396	hsa-miR-3136-3p	CLIP-seq
MIRT1229397	hsa-miR-3152-3p	CLIP-seq
MIRT1229398	hsa-miR-3183	CLIP-seq
MIRT1229399	hsa-miR-3200-5p	CLIP-seq
MIRT1229400	hsa-miR-342-5p	CLIP-seq
MIRT1229401	hsa-miR-3616-5p	CLIP-seq
MIRT1229402	hsa-miR-3647-5p	CLIP-seq
MIRT1229403	hsa-miR-3653	CLIP-seq
MIRT1229404	hsa-miR-3658	CLIP-seq
MIRT1229405	hsa-miR-3689d	CLIP-seq
MIRT1229406	hsa-miR-381	CLIP-seq
MIRT1229407	hsa-miR-3916	CLIP-seq
MIRT1229408	hsa-miR-421	CLIP-seq
MIRT1229409	hsa-miR-4251	CLIP-seq
MIRT1229410	hsa-miR-4300	CLIP-seq
MIRT1229411	hsa-miR-4314	CLIP-seq
MIRT1229412	hsa-miR-4329	CLIP-seq
MIRT1229413	hsa-miR-4447	CLIP-seq
MIRT1229414	hsa-miR-4451	CLIP-seq
MIRT1229415	hsa-miR-4468	CLIP-seq
MIRT1229416	hsa-miR-4472	CLIP-seq
MIRT1229417	hsa-miR-4476	CLIP-seq
MIRT1229418	hsa-miR-4503	CLIP-seq
MIRT1229419	hsa-miR-4508	CLIP-seq
MIRT1229420	hsa-miR-4643	CLIP-seq
MIRT1229421	hsa-miR-4645-5p	CLIP-seq
MIRT1229422	hsa-miR-4650-5p	CLIP-seq
MIRT1229423	hsa-miR-4651	CLIP-seq
MIRT1229424	hsa-miR-466	CLIP-seq
MIRT1229425	hsa-miR-4664-5p	CLIP-seq
MIRT1229426	hsa-miR-4666-3p	CLIP-seq
MIRT1229427	hsa-miR-4667-5p	CLIP-seq
MIRT1229428	hsa-miR-4673	CLIP-seq
MIRT1229429	hsa-miR-4675	CLIP-seq
MIRT1229430	hsa-miR-4690-3p	CLIP-seq
MIRT1229431	hsa-miR-4700-3p	CLIP-seq
MIRT1229432	hsa-miR-4700-5p	CLIP-seq
MIRT1229433	hsa-miR-4709-5p	CLIP-seq
MIRT1229434	hsa-miR-4723-3p	CLIP-seq
MIRT1229435	hsa-miR-4724-3p	CLIP-seq
MIRT1229436	hsa-miR-4729	CLIP-seq
MIRT1229437	hsa-miR-4741	CLIP-seq
MIRT1229438	hsa-miR-4746-5p	CLIP-seq
MIRT1229439	hsa-miR-4761-5p	CLIP-seq
MIRT1229440	hsa-miR-4789-3p	CLIP-seq
MIRT1229441	hsa-miR-4789-5p	CLIP-seq
MIRT1229442	hsa-miR-4795-5p	CLIP-seq
MIRT1229443	hsa-miR-513a-3p	CLIP-seq
MIRT1229444	hsa-miR-513a-5p	CLIP-seq
MIRT1229445	hsa-miR-573	CLIP-seq
MIRT1229446	hsa-miR-608	CLIP-seq
MIRT1229447	hsa-miR-616	CLIP-seq
MIRT1229448	hsa-miR-637	CLIP-seq
MIRT1229449	hsa-miR-658	CLIP-seq
MIRT1229450	hsa-miR-663b	CLIP-seq
MIRT1229451	hsa-miR-920	CLIP-seq
MIRT2067179	hsa-miR-1207-5p	CLIP-seq
MIRT1229383	hsa-miR-1252	CLIP-seq
MIRT1229385	hsa-miR-128	CLIP-seq
MIRT2067180	hsa-miR-132	CLIP-seq
MIRT1229387	hsa-miR-205	CLIP-seq
MIRT2067181	hsa-miR-212	CLIP-seq
MIRT1229389	hsa-miR-27a	CLIP-seq
MIRT1229390	hsa-miR-27b	CLIP-seq
MIRT1229391	hsa-miR-298	CLIP-seq
MIRT1229397	hsa-miR-3152-3p	CLIP-seq
MIRT1229400	hsa-miR-342-5p	CLIP-seq
MIRT1229403	hsa-miR-3653	CLIP-seq
MIRT1229404	hsa-miR-3658	CLIP-seq
MIRT1229405	hsa-miR-3689d	CLIP-seq
MIRT2067182	hsa-miR-4292	CLIP-seq
MIRT1229410	hsa-miR-4300	CLIP-seq
MIRT1229411	hsa-miR-4314	CLIP-seq
MIRT1229415	hsa-miR-4468	CLIP-seq
MIRT1229417	hsa-miR-4476	CLIP-seq
MIRT1229418	hsa-miR-4503	CLIP-seq
MIRT2067183	hsa-miR-4514	CLIP-seq
MIRT1229423	hsa-miR-4651	CLIP-seq
MIRT1229425	hsa-miR-4664-5p	CLIP-seq
MIRT1229427	hsa-miR-4667-5p	CLIP-seq
MIRT1229430	hsa-miR-4690-3p	CLIP-seq
MIRT2067184	hsa-miR-4692	CLIP-seq
MIRT1229432	hsa-miR-4700-5p	CLIP-seq
MIRT1229433	hsa-miR-4709-5p	CLIP-seq
MIRT1229435	hsa-miR-4724-3p	CLIP-seq
MIRT2067185	hsa-miR-4725-5p	CLIP-seq
MIRT2067186	hsa-miR-4763-3p	CLIP-seq
MIRT2067187	hsa-miR-504	CLIP-seq
MIRT1229443	hsa-miR-513a-3p	CLIP-seq
MIRT1229444	hsa-miR-513a-5p	CLIP-seq
MIRT1229446	hsa-miR-608	CLIP-seq
MIRT1229448	hsa-miR-637	CLIP-seq
MIRT1229449	hsa-miR-658	CLIP-seq
MIRT1229451	hsa-miR-920	CLIP-seq
MIRT2067188	hsa-miR-940	CLIP-seq
MIRT2294704	hsa-miR-103a	CLIP-seq
MIRT2294705	hsa-miR-105	CLIP-seq
MIRT2294706	hsa-miR-107	CLIP-seq
MIRT2067179	hsa-miR-1207-5p	CLIP-seq
MIRT2294707	hsa-miR-1224-3p	CLIP-seq
MIRT2294708	hsa-miR-1228	CLIP-seq
MIRT2294709	hsa-miR-1236	CLIP-seq
MIRT1229383	hsa-miR-1252	CLIP-seq
MIRT2294710	hsa-miR-1253	CLIP-seq
MIRT2294711	hsa-miR-1261	CLIP-seq
MIRT1229384	hsa-miR-1264	CLIP-seq
MIRT2294712	hsa-miR-1271	CLIP-seq
MIRT2294713	hsa-miR-1276	CLIP-seq
MIRT1229385	hsa-miR-128	CLIP-seq
MIRT1229386	hsa-miR-1284	CLIP-seq
MIRT2294714	hsa-miR-1297	CLIP-seq
MIRT2067180	hsa-miR-132	CLIP-seq
MIRT2294715	hsa-miR-1321	CLIP-seq
MIRT2294716	hsa-miR-138	CLIP-seq
MIRT2294717	hsa-miR-148a	CLIP-seq
MIRT2294718	hsa-miR-148b	CLIP-seq
MIRT2294719	hsa-miR-152	CLIP-seq
MIRT2294720	hsa-miR-153	CLIP-seq
MIRT2294721	hsa-miR-15a	CLIP-seq
MIRT2294722	hsa-miR-15b	CLIP-seq
MIRT2294723	hsa-miR-16	CLIP-seq
MIRT2294724	hsa-miR-182	CLIP-seq
MIRT2294725	hsa-miR-1825	CLIP-seq
MIRT2294726	hsa-miR-1913	CLIP-seq
MIRT2294727	hsa-miR-195	CLIP-seq
MIRT2294728	hsa-miR-1972	CLIP-seq
MIRT1229387	hsa-miR-205	CLIP-seq
MIRT2067181	hsa-miR-212	CLIP-seq
MIRT2294729	hsa-miR-214	CLIP-seq
MIRT1229388	hsa-miR-2277-3p	CLIP-seq
MIRT2294730	hsa-miR-26a	CLIP-seq
MIRT2294731	hsa-miR-26b	CLIP-seq
MIRT1229389	hsa-miR-27a	CLIP-seq
MIRT1229390	hsa-miR-27b	CLIP-seq
MIRT1229391	hsa-miR-298	CLIP-seq
MIRT1229392	hsa-miR-300	CLIP-seq
MIRT2294732	hsa-miR-3117-3p	CLIP-seq
MIRT2294733	hsa-miR-3123	CLIP-seq
MIRT1229393	hsa-miR-3125	CLIP-seq
MIRT1229394	hsa-miR-3126-5p	CLIP-seq
MIRT2294734	hsa-miR-3130-3p	CLIP-seq
MIRT1229395	hsa-miR-3132	CLIP-seq
MIRT1229397	hsa-miR-3152-3p	CLIP-seq
MIRT2294735	hsa-miR-3154	CLIP-seq
MIRT2294736	hsa-miR-3157-5p	CLIP-seq
MIRT2294737	hsa-miR-3162-5p	CLIP-seq
MIRT2294738	hsa-miR-3165	CLIP-seq
MIRT1229398	hsa-miR-3183	CLIP-seq
MIRT2294739	hsa-miR-3193	CLIP-seq
MIRT1229399	hsa-miR-3200-5p	CLIP-seq
MIRT2294740	hsa-miR-320e	CLIP-seq
MIRT2294741	hsa-miR-324-3p	CLIP-seq
MIRT2294742	hsa-miR-329	CLIP-seq
MIRT2294743	hsa-miR-338-3p	CLIP-seq
MIRT1229400	hsa-miR-342-5p	CLIP-seq
MIRT2294744	hsa-miR-3614-5p	CLIP-seq
MIRT2294745	hsa-miR-3619-5p	CLIP-seq
MIRT2294746	hsa-miR-3622a-5p	CLIP-seq
MIRT2294747	hsa-miR-362-3p	CLIP-seq
MIRT1229403	hsa-miR-3653	CLIP-seq
MIRT1229404	hsa-miR-3658	CLIP-seq
MIRT2294748	hsa-miR-3667-3p	CLIP-seq
MIRT2294749	hsa-miR-3673	CLIP-seq
MIRT1229405	hsa-miR-3689d	CLIP-seq
MIRT2294750	hsa-miR-3691-3p	CLIP-seq
MIRT2294751	hsa-miR-377	CLIP-seq
MIRT1229406	hsa-miR-381	CLIP-seq
MIRT2294752	hsa-miR-3914	CLIP-seq
MIRT1229407	hsa-miR-3916	CLIP-seq
MIRT1229408	hsa-miR-421	CLIP-seq
MIRT2294753	hsa-miR-424	CLIP-seq
MIRT1229409	hsa-miR-4251	CLIP-seq
MIRT2294754	hsa-miR-4291	CLIP-seq
MIRT2067182	hsa-miR-4292	CLIP-seq
MIRT1229410	hsa-miR-4300	CLIP-seq
MIRT2294755	hsa-miR-4311	CLIP-seq
MIRT1229411	hsa-miR-4314	CLIP-seq
MIRT2294756	hsa-miR-4323	CLIP-seq
MIRT1229412	hsa-miR-4329	CLIP-seq
MIRT2294757	hsa-miR-4423-3p	CLIP-seq
MIRT2294758	hsa-miR-4436b-5p	CLIP-seq
MIRT1229413	hsa-miR-4447	CLIP-seq
MIRT1229414	hsa-miR-4451	CLIP-seq
MIRT2294759	hsa-miR-4465	CLIP-seq
MIRT1229415	hsa-miR-4468	CLIP-seq
MIRT1229416	hsa-miR-4472	CLIP-seq
MIRT1229417	hsa-miR-4476	CLIP-seq
MIRT2294760	hsa-miR-448	CLIP-seq
MIRT2294761	hsa-miR-4494	CLIP-seq
MIRT1229418	hsa-miR-4503	CLIP-seq
MIRT2067183	hsa-miR-4514	CLIP-seq
MIRT2294762	hsa-miR-4520a-5p	CLIP-seq
MIRT2294763	hsa-miR-4520b-5p	CLIP-seq
MIRT2294764	hsa-miR-4530	CLIP-seq
MIRT2294765	hsa-miR-4640-5p	CLIP-seq
MIRT1229420	hsa-miR-4643	CLIP-seq
MIRT1229422	hsa-miR-4650-5p	CLIP-seq
MIRT1229423	hsa-miR-4651	CLIP-seq
MIRT1229424	hsa-miR-466	CLIP-seq
MIRT1229425	hsa-miR-4664-5p	CLIP-seq
MIRT1229426	hsa-miR-4666-3p	CLIP-seq
MIRT1229427	hsa-miR-4667-5p	CLIP-seq
MIRT1229430	hsa-miR-4690-3p	CLIP-seq
MIRT2294766	hsa-miR-4690-5p	CLIP-seq
MIRT2067184	hsa-miR-4692	CLIP-seq
MIRT1229431	hsa-miR-4700-3p	CLIP-seq
MIRT1229432	hsa-miR-4700-5p	CLIP-seq
MIRT2294767	hsa-miR-4707-5p	CLIP-seq
MIRT1229433	hsa-miR-4709-5p	CLIP-seq
MIRT1229434	hsa-miR-4723-3p	CLIP-seq
MIRT1229435	hsa-miR-4724-3p	CLIP-seq
MIRT2067185	hsa-miR-4725-5p	CLIP-seq
MIRT2294768	hsa-miR-4726-5p	CLIP-seq
MIRT1229436	hsa-miR-4729	CLIP-seq
MIRT2294769	hsa-miR-4736	CLIP-seq
MIRT2294770	hsa-miR-4739	CLIP-seq
MIRT2294771	hsa-miR-4743	CLIP-seq
MIRT2294772	hsa-miR-4749-3p	CLIP-seq
MIRT2294773	hsa-miR-4756-5p	CLIP-seq
MIRT1229439	hsa-miR-4761-5p	CLIP-seq
MIRT2067186	hsa-miR-4763-3p	CLIP-seq
MIRT1229440	hsa-miR-4789-3p	CLIP-seq
MIRT1229441	hsa-miR-4789-5p	CLIP-seq
MIRT2294774	hsa-miR-4793-3p	CLIP-seq
MIRT2294775	hsa-miR-497	CLIP-seq
MIRT2294776	hsa-miR-499a-5p	CLIP-seq
MIRT2294777	hsa-miR-500a	CLIP-seq
MIRT2067187	hsa-miR-504	CLIP-seq
MIRT2294778	hsa-miR-508-5p	CLIP-seq
MIRT1229443	hsa-miR-513a-3p	CLIP-seq
MIRT1229444	hsa-miR-513a-5p	CLIP-seq
MIRT2294779	hsa-miR-548q	CLIP-seq
MIRT2294780	hsa-miR-583	CLIP-seq
MIRT2294781	hsa-miR-584	CLIP-seq
MIRT1229446	hsa-miR-608	CLIP-seq
MIRT1229447	hsa-miR-616	CLIP-seq
MIRT1229448	hsa-miR-637	CLIP-seq
MIRT2294782	hsa-miR-651	CLIP-seq
MIRT1229449	hsa-miR-658	CLIP-seq
MIRT2294783	hsa-miR-761	CLIP-seq
MIRT2294784	hsa-miR-766	CLIP-seq
MIRT2294785	hsa-miR-873	CLIP-seq
MIRT2294786	hsa-miR-9	CLIP-seq
MIRT1229451	hsa-miR-920	CLIP-seq
MIRT2294787	hsa-miR-922	CLIP-seq
MIRT2067188	hsa-miR-940	CLIP-seq
MIRT2294788	hsa-miR-96	CLIP-seq
MIRT1229385	hsa-miR-128	CLIP-seq
MIRT1229387	hsa-miR-205	CLIP-seq
MIRT1229389	hsa-miR-27a	CLIP-seq
MIRT1229390	hsa-miR-27b	CLIP-seq
MIRT1229400	hsa-miR-342-5p	CLIP-seq
MIRT1229410	hsa-miR-4300	CLIP-seq
MIRT1229411	hsa-miR-4314	CLIP-seq
MIRT1229415	hsa-miR-4468	CLIP-seq
MIRT1229418	hsa-miR-4503	CLIP-seq
MIRT1229423	hsa-miR-4651	CLIP-seq
MIRT1229425	hsa-miR-4664-5p	CLIP-seq
MIRT1229427	hsa-miR-4667-5p	CLIP-seq
MIRT1229432	hsa-miR-4700-5p	CLIP-seq
MIRT1229443	hsa-miR-513a-3p	CLIP-seq
MIRT1229444	hsa-miR-513a-5p	CLIP-seq
MIRT1229446	hsa-miR-608	CLIP-seq
MIRT1229448	hsa-miR-637	CLIP-seq
MIRT1229451	hsa-miR-920	CLIP-seq
MIRT2294705	hsa-miR-105	CLIP-seq
MIRT2294707	hsa-miR-1224-3p	CLIP-seq
MIRT1229386	hsa-miR-1284	CLIP-seq
MIRT2592547	hsa-miR-1302	CLIP-seq
MIRT2067180	hsa-miR-132	CLIP-seq
MIRT2294715	hsa-miR-1321	CLIP-seq
MIRT2294716	hsa-miR-138	CLIP-seq
MIRT2294720	hsa-miR-153	CLIP-seq
MIRT2294724	hsa-miR-182	CLIP-seq
MIRT2294728	hsa-miR-1972	CLIP-seq
MIRT2067181	hsa-miR-212	CLIP-seq
MIRT2294729	hsa-miR-214	CLIP-seq
MIRT1229392	hsa-miR-300	CLIP-seq
MIRT2294732	hsa-miR-3117-3p	CLIP-seq
MIRT2592548	hsa-miR-3122	CLIP-seq
MIRT2294737	hsa-miR-3162-5p	CLIP-seq
MIRT1229398	hsa-miR-3183	CLIP-seq
MIRT2294739	hsa-miR-3193	CLIP-seq
MIRT2592549	hsa-miR-320a	CLIP-seq
MIRT2592550	hsa-miR-320b	CLIP-seq
MIRT2592551	hsa-miR-320c	CLIP-seq
MIRT2592552	hsa-miR-320d	CLIP-seq
MIRT2294740	hsa-miR-320e	CLIP-seq
MIRT2294743	hsa-miR-338-3p	CLIP-seq
MIRT2294744	hsa-miR-3614-5p	CLIP-seq
MIRT2294745	hsa-miR-3619-5p	CLIP-seq
MIRT2294746	hsa-miR-3622a-5p	CLIP-seq
MIRT2592553	hsa-miR-3649	CLIP-seq
MIRT1229405	hsa-miR-3689d	CLIP-seq
MIRT2294750	hsa-miR-3691-3p	CLIP-seq
MIRT2294751	hsa-miR-377	CLIP-seq
MIRT1229406	hsa-miR-381	CLIP-seq
MIRT2592554	hsa-miR-3913-5p	CLIP-seq
MIRT1229408	hsa-miR-421	CLIP-seq
MIRT2067182	hsa-miR-4292	CLIP-seq
MIRT2592555	hsa-miR-4298	CLIP-seq
MIRT2294757	hsa-miR-4423-3p	CLIP-seq
MIRT2592556	hsa-miR-4429	CLIP-seq
MIRT2294760	hsa-miR-448	CLIP-seq
MIRT2294762	hsa-miR-4520a-5p	CLIP-seq
MIRT2294763	hsa-miR-4520b-5p	CLIP-seq
MIRT2294764	hsa-miR-4530	CLIP-seq
MIRT1229421	hsa-miR-4645-5p	CLIP-seq
MIRT1229422	hsa-miR-4650-5p	CLIP-seq
MIRT1229426	hsa-miR-4666-3p	CLIP-seq
MIRT1229428	hsa-miR-4673	CLIP-seq
MIRT2592557	hsa-miR-4688	CLIP-seq
MIRT2294766	hsa-miR-4690-5p	CLIP-seq
MIRT1229433	hsa-miR-4709-5p	CLIP-seq
MIRT1229434	hsa-miR-4723-3p	CLIP-seq
MIRT2067185	hsa-miR-4725-5p	CLIP-seq
MIRT2294770	hsa-miR-4739	CLIP-seq
MIRT2294771	hsa-miR-4743	CLIP-seq
MIRT1229438	hsa-miR-4746-5p	CLIP-seq
MIRT2294773	hsa-miR-4756-5p	CLIP-seq
MIRT2592558	hsa-miR-486-3p	CLIP-seq
MIRT2067187	hsa-miR-504	CLIP-seq
MIRT2294778	hsa-miR-508-5p	CLIP-seq
MIRT2294779	hsa-miR-548q	CLIP-seq
MIRT1229448	hsa-miR-637	CLIP-seq
MIRT2294782	hsa-miR-651	CLIP-seq
MIRT2294783	hsa-miR-761	CLIP-seq
MIRT2294784	hsa-miR-766	CLIP-seq
MIRT2294705	hsa-miR-105	CLIP-seq
MIRT2294707	hsa-miR-1224-3p	CLIP-seq
MIRT2294711	hsa-miR-1261	CLIP-seq
MIRT1229386	hsa-miR-1284	CLIP-seq
MIRT2592547	hsa-miR-1302	CLIP-seq
MIRT2067180	hsa-miR-132	CLIP-seq
MIRT2294715	hsa-miR-1321	CLIP-seq
MIRT2294716	hsa-miR-138	CLIP-seq
MIRT2294720	hsa-miR-153	CLIP-seq
MIRT2294724	hsa-miR-182	CLIP-seq
MIRT2294728	hsa-miR-1972	CLIP-seq
MIRT2067181	hsa-miR-212	CLIP-seq
MIRT2294729	hsa-miR-214	CLIP-seq
MIRT1229392	hsa-miR-300	CLIP-seq
MIRT2294732	hsa-miR-3117-3p	CLIP-seq
MIRT2592548	hsa-miR-3122	CLIP-seq
MIRT2294737	hsa-miR-3162-5p	CLIP-seq
MIRT2294738	hsa-miR-3165	CLIP-seq
MIRT1229398	hsa-miR-3183	CLIP-seq
MIRT2294739	hsa-miR-3193	CLIP-seq
MIRT2592549	hsa-miR-320a	CLIP-seq
MIRT2592550	hsa-miR-320b	CLIP-seq
MIRT2592551	hsa-miR-320c	CLIP-seq
MIRT2592552	hsa-miR-320d	CLIP-seq
MIRT2294740	hsa-miR-320e	CLIP-seq
MIRT2294743	hsa-miR-338-3p	CLIP-seq
MIRT2294744	hsa-miR-3614-5p	CLIP-seq
MIRT2294745	hsa-miR-3619-5p	CLIP-seq
MIRT2294746	hsa-miR-3622a-5p	CLIP-seq
MIRT2592553	hsa-miR-3649	CLIP-seq
MIRT1229405	hsa-miR-3689d	CLIP-seq
MIRT2294750	hsa-miR-3691-3p	CLIP-seq
MIRT1229406	hsa-miR-381	CLIP-seq
MIRT2592554	hsa-miR-3913-5p	CLIP-seq
MIRT1229408	hsa-miR-421	CLIP-seq
MIRT2067182	hsa-miR-4292	CLIP-seq
MIRT2592555	hsa-miR-4298	CLIP-seq
MIRT2294757	hsa-miR-4423-3p	CLIP-seq
MIRT2592556	hsa-miR-4429	CLIP-seq
MIRT2294760	hsa-miR-448	CLIP-seq
MIRT2294762	hsa-miR-4520a-5p	CLIP-seq
MIRT2294763	hsa-miR-4520b-5p	CLIP-seq
MIRT2294764	hsa-miR-4530	CLIP-seq
MIRT1229421	hsa-miR-4645-5p	CLIP-seq
MIRT1229422	hsa-miR-4650-5p	CLIP-seq
MIRT1229426	hsa-miR-4666-3p	CLIP-seq
MIRT1229428	hsa-miR-4673	CLIP-seq
MIRT2592557	hsa-miR-4688	CLIP-seq
MIRT2294766	hsa-miR-4690-5p	CLIP-seq
MIRT1229433	hsa-miR-4709-5p	CLIP-seq
MIRT1229434	hsa-miR-4723-3p	CLIP-seq
MIRT2067185	hsa-miR-4725-5p	CLIP-seq
MIRT2294770	hsa-miR-4739	CLIP-seq
MIRT2294771	hsa-miR-4743	CLIP-seq
MIRT1229438	hsa-miR-4746-5p	CLIP-seq
MIRT2294773	hsa-miR-4756-5p	CLIP-seq
MIRT2592558	hsa-miR-486-3p	CLIP-seq
MIRT2067187	hsa-miR-504	CLIP-seq
MIRT2294778	hsa-miR-508-5p	CLIP-seq
MIRT2294779	hsa-miR-548q	CLIP-seq
MIRT1229448	hsa-miR-637	CLIP-seq
MIRT2294782	hsa-miR-651	CLIP-seq
MIRT2294783	hsa-miR-761	CLIP-seq
MIRT2294784	hsa-miR-766	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	16964284
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001649	Process	Osteoblast differentiation	HDA	16210410
GO:0001850	Function	Complement component C3a binding	IDA	17070910
GO:0001851	Function	Complement component C3b binding	IDA	17070910
GO:0002639	Process	Positive regulation of immunoglobulin production	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	ISS
GO:0003714	Function	Transcription corepressor activity	IDA	18487222
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0005515	Function	Protein binding	IPI	11302691, 12065415, 16319068, 16964284, 19640993, 19906925, 20134482, 20195357, 20959514, 21746876, 24380853, 30021884, 30337686, 31522117, 31899195, 32296183
GO:0005634	Component	Nucleus	IDA	16964284, 20959514, 24732013, 31899195
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	16130169
GO:0005654	Component	Nucleoplasm	IDA	12466959
GO:0005737	Component	Cytoplasm	IDA	16964284, 31899195
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	24732013
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	17008324, 18339324, 20959514, 28017329
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS	14500729
GO:0005769	Component	Early endosome	IDA	24732013
GO:0005886	Component	Plasma membrane	IDA	15274632, 22997079, 24003225, 24732013
GO:0005886	Component	Plasma membrane	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	14500729
GO:0007005	Process	Mitochondrion organization	IBA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007005	Process	Mitochondrion organization	IMP	17008324
GO:0007005	Process	Mitochondrion organization	NAS	18339324
GO:0007165	Process	Signal transduction	TAS	16130169
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	18487222
GO:0009986	Component	Cell surface	IDA	22417827, 22997079, 24732013
GO:0009986	Component	Cell surface	IEA
GO:0010628	Process	Positive regulation of gene expression	IGI	26310625
GO:0010944	Process	Negative regulation of transcription by competitive promoter binding	IDA	18487222
GO:0016020	Component	Membrane	HDA	16210410, 19946888
GO:0016020	Component	Membrane	IEA
GO:0019899	Function	Enzyme binding	IPI	23921388
GO:0030308	Process	Negative regulation of cell growth	IMP	12065415
GO:0031871	Function	Proteinase activated receptor binding	IPI	24732013
GO:0032740	Process	Positive regulation of interleukin-17 production	IMP	31899195
GO:0035632	Component	Mitochondrial prohibitin complex	IDA	31522117
GO:0035632	Component	Mitochondrial prohibitin complex	IEA
GO:0035632	Component	Mitochondrial prohibitin complex	IPI	20959514
GO:0039529	Process	RIG-I signaling pathway	IDA	31522117
GO:0039529	Process	RIG-I signaling pathway	IEA
GO:0040029	Process	Epigenetic regulation of gene expression	IDA	12466959
GO:0042113	Process	B cell activation	IEA
GO:0042113	Process	B cell activation	ISS
GO:0042177	Process	Negative regulation of protein catabolic process	IMP	24732013
GO:0042826	Function	Histone deacetylase binding	IPI	16964284
GO:0042981	Process	Regulation of apoptotic process	TAS	16130169
GO:0043525	Process	Positive regulation of neuron apoptotic process	IGI	26310625
GO:0044830	Process	Host-mediated perturbation of viral RNA genome replication	IEA
GO:0044830	Process	Host-mediated perturbation of viral RNA genome replication	ISS
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IMP	24732013
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12065415, 12566959
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	18487222
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	14500729
GO:0045917	Process	Positive regulation of complement activation	IDA	17070910
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046718	Process	Symbiont entry into host cell	ISS
GO:0046982	Function	Protein heterodimerization activity	IPI	28017329
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	ISS
GO:0050821	Process	Protein stabilization	IDA	18339324
GO:0050821	Process	Protein stabilization	IMP	17008324
GO:0050847	Process	Progesterone receptor signaling pathway	IDA	16964284
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IDA	16964284
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IMP	18487222
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IMP	24732013
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	22417827
GO:0071354	Process	Cellular response to interleukin-6	IDA	17324931
GO:0071897	Process	DNA biosynthetic process	IEA
GO:0071897	Process	DNA biosynthetic process	IEA
GO:0072538	Process	T-helper 17 type immune response	IDA	31899195
GO:0140374	Process	Antiviral innate immune response	IDA	31522117
GO:0140374	Process	Antiviral innate immune response	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	ISS
GO:2000323	Process	Negative regulation of nuclear receptor-mediated glucocorticoid signaling pathway	IDA	16964284

Other IDs

• MIM: 176705
• HGNC: 8912
• e!Ensembl: ENSG00000167085

Protein

• UniProt ID: P35232
• Protein name: Prohibitin 1
• Protein function: Protein with pleiotropic attributes mediated in a cell-compartment- and tissue-specific manner, which include the plasma membrane-associated cell signaling functions, mitochondrial chaperone, and transcriptional co-regulator of transcription fac
• PDB: 8RRH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01145	Band_7	28 → 210	SPFH domain / Band 7 family	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed in different tissues.
• Sequence:

  MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPW
  VQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLP
  SITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFT
  EAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRK
  LEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ

• Sequence length: 272

Pathways

KEGG:

Virion - Flavivirus and Alphavirus

Reactome:

RAF activation
Signaling by moderate kinase activity BRAF mutants
Paradoxical activation of RAF signaling by kinase inactive BRAF
Processing of SMDT1
Signaling downstream of RAS mutants

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast cancer, susceptibility to	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PHB1-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOSES, SUBSTANCE-INDUCED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	23023919		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	15378696		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18789835		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	15378696		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	15378696		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	15378696		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	23587357	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	28831118, 33942972, 39201500	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30577465		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30185797		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	30185797	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	21741794	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	27558591		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	28533516	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	GWASCAT_DG	28533516		★☆☆☆☆ Found in Text Mining only
Autoimmune Pancreatitis	Autoimmune pancreatitis	Pubtator	25932630	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	22212092	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	1540973, 17004108, 18397521		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11377649, 12354477, 14500355, 15141164, 17004108, 18494604, 18709484, 21246238, 22994754, 23715748, 24247619, 26450374, 28123587, 28272969, 28294412, 7819270, 8349162, 8809404		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14500729, 15141164, 18397521, 19129556, 23244120, 24247619, 27485113, 28294412, 29433565, 30180900, 32865342	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	20069396	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	28272969	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	17465217, 20069396, 23587357, 24133587, 30523154	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	12376462		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	24247619	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20186755, 21896168, 30523154	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24133587		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24966933	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28427435	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23510786	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	15378696		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	15378696		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12821355, 18183577, 22994754, 28427435, 8349162		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	26623724		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28714328, 29808474		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28714328		★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28533516		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24380853, 27981602		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24380853	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	27981602		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28551807		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11162143		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	31558419		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	33942972	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	33942972	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	19327358, 20872832, 23494124		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29100316		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	39201500	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	Pubtator	28831118	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23863811, 28399645		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23863811, 28399645		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30967257		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31691259, 31706320		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	26623724		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31684984		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31205517		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	25444511		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25444511		★☆☆☆☆ Found in Text Mining only
Epithelial tumor of ovary	Epithelial Tumor Of Ovary	BEFREE	28427435		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	15986332		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	15986332, 20069396	Associate	★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	18384941		★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	20186755	Associate	★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	19207009		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	12112852		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	28831118, 30577465		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	27084680		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30597288, 30597867		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30597867, 32098295	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30597288, 30597867		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25777779		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	22324369	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28551807		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29029444		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	22669161	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	15378696, 21364753		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31555955		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	30717609		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17135366, 19327358, 19710421		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	17135366		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	24358121	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28440457, 29029444		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28440457	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18763282, 20186755, 21318481, 30523154		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21472284		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31558419		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	20186755		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29620269		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21896168	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24133587	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	20618332	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11377649, 12354477, 14500355, 15141164, 17004108, 18494604, 18709484, 19071013, 21246238, 22994754, 23244120, 23715748, 24247619, 26450374, 28272969, 28294412, 7819270, 8809404		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31205517		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	15986332		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	27084680		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27981602, 28399645, 30523154, 31558419		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24133587		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12821355, 18183577, 22994754, 28427435, 8349162		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30185797, 31334335		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14968116, 16733518, 18384941, 19635783, 22505583, 26450374, 28240870, 28504694		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	15378696, 21364753		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18709484, 24879411, 28294412, 30555578		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15823758, 18384941, 21296110, 22410782, 22994754, 23098474, 26450374, 28399645, 29029444, 29222040, 29415747, 29784973, 30396985, 30523154, 30669391, 30717609, 31205517		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	GWASCAT_DG	29299148		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15614618, 17004108		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	8809404		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23624368, 28562344, 29126391		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28562344, 29126391	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	30396985		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	25112877, 28831118, 34034859	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36346305	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29242126, 30049713		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30886235		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36382614	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11852914, 12821355, 14500355, 15614618, 15717328, 15823758, 17043753, 18487222, 18763282, 19071013, 19207009, 19635783, 20069396, 21152868, 22179832, 23098474, 23244120, 23455180, 23715748, 24133587, 24380853, 24879411, 25777779, 26056316, 26623724, 27084680, 27557820, 28399645, 28504694, 29126391, 29620269, 29662647, 30523154, 30560903, 30714136, 30886235, 31558419, 31684984, 8349162, 8612677, 8809404		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	31391345		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21061155	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30998507		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24133587, 26056316, 28414306		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	20186755		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15823758, 20186755, 21296110, 28399645, 28432106, 30157935, 30538468, 31118075		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20186755	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	28272969		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	22324369	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27802335	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	27802335		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	24966933	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	12821355, 18183577, 22994754, 28427435, 8349162		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18183577	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28427435, 32169072	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25344214, 30185797, 31334335		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25344214, 30185797	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19207009		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28062948		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28432106		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14968116, 16733518, 18384941, 19635783, 22505583, 26450374, 28240870, 28504694		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	14968116, 18487222, 22179832, 22505583, 24103426, 37210546	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16951178		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19635783, 22179832		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21896168	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	17618601		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22521224	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29620269		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	CTD_human_DG	18504422		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	19034380		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren's Syndrome	Sjogren syndrome	Pubtator	25932630	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19664078, 20069396, 28404970		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18709484, 24879411, 28294412, 30555578		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12923326, 15259061, 16718772, 20069396, 20440860, 23098474, 24879411, 28294412, 35325318	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	15378696, 21364753		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18709484		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	28831118	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21152868		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	17465217		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17465217	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	29415747		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	31391345	Associate	★☆☆☆☆ Found in Text Mining only