PGR (progesterone receptor)

Gene

• Entrez ID: 5241
• Gene name: Progesterone receptor
• Gene symbol: PGR
• Synonyms (NCBI Gene): NR3C3, PR
• Chromosome: 11
• Chromosome location: 11q22.1
• Summary: This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021282	hsa-miR-126-3p	Reporter assay;Western blot	21526342
MIRT052993	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22492871
MIRT731058	hsa-miR-378a-3p	qRT-PCR, Luciferase reporter assay, Western blot	25150622
MIRT731058	hsa-miR-378a-3p	qRT-PCR, Luciferase reporter assay, Western blot	25150622
MIRT731058	hsa-miR-378a-3p	qRT-PCR, Luciferase reporter assay, Western blot	25150622
MIRT731058	hsa-miR-378a-3p	qRT-PCR, Luciferase reporter assay, Western blot	25150622
MIRT737159	hsa-miR-301a-5p	Immunoprecipitaion (IP), RNA-seq, qRT-PCR, In situ hybridization	33408778
MIRT1228338	hsa-let-7a	CLIP-seq
MIRT1228339	hsa-let-7b	CLIP-seq
MIRT1228340	hsa-let-7c	CLIP-seq
MIRT1228341	hsa-let-7d	CLIP-seq
MIRT1228342	hsa-let-7e	CLIP-seq
MIRT1228343	hsa-let-7f	CLIP-seq
MIRT1228344	hsa-let-7g	CLIP-seq
MIRT1228345	hsa-let-7i	CLIP-seq
MIRT1228346	hsa-miR-103b	CLIP-seq
MIRT1228347	hsa-miR-1179	CLIP-seq
MIRT1228348	hsa-miR-1200	CLIP-seq
MIRT1228349	hsa-miR-1206	CLIP-seq
MIRT1228350	hsa-miR-1236	CLIP-seq
MIRT1228351	hsa-miR-1257	CLIP-seq
MIRT1228352	hsa-miR-125a-5p	CLIP-seq
MIRT1228353	hsa-miR-125b	CLIP-seq
MIRT1228354	hsa-miR-1261	CLIP-seq
MIRT1228355	hsa-miR-1268	CLIP-seq
MIRT1228356	hsa-miR-1268b	CLIP-seq
MIRT1228357	hsa-miR-1271	CLIP-seq
MIRT1228358	hsa-miR-1279	CLIP-seq
MIRT1228359	hsa-miR-1283	CLIP-seq
MIRT1228360	hsa-miR-1290	CLIP-seq
MIRT1228361	hsa-miR-129-5p	CLIP-seq
MIRT1228362	hsa-miR-1298	CLIP-seq
MIRT1228363	hsa-miR-1303	CLIP-seq
MIRT1228364	hsa-miR-1304	CLIP-seq
MIRT1228365	hsa-miR-1324	CLIP-seq
MIRT1228366	hsa-miR-1470	CLIP-seq
MIRT1228367	hsa-miR-181a	CLIP-seq
MIRT1228368	hsa-miR-181b	CLIP-seq
MIRT1228369	hsa-miR-181c	CLIP-seq
MIRT1228370	hsa-miR-181d	CLIP-seq
MIRT1228371	hsa-miR-182	CLIP-seq
MIRT1228372	hsa-miR-197	CLIP-seq
MIRT1228373	hsa-miR-218	CLIP-seq
MIRT1228374	hsa-miR-219-2-3p	CLIP-seq
MIRT1228375	hsa-miR-2276	CLIP-seq
MIRT1228376	hsa-miR-2964a-3p	CLIP-seq
MIRT1228377	hsa-miR-3074-3p	CLIP-seq
MIRT1228378	hsa-miR-3074-5p	CLIP-seq
MIRT1228379	hsa-miR-30a	CLIP-seq
MIRT1228380	hsa-miR-30b	CLIP-seq
MIRT1228381	hsa-miR-30c	CLIP-seq
MIRT1228382	hsa-miR-30d	CLIP-seq
MIRT1228383	hsa-miR-30e	CLIP-seq
MIRT1228384	hsa-miR-3120-3p	CLIP-seq
MIRT1228385	hsa-miR-3121-3p	CLIP-seq
MIRT1228386	hsa-miR-3122	CLIP-seq
MIRT1228387	hsa-miR-3123	CLIP-seq
MIRT1228388	hsa-miR-3129-3p	CLIP-seq
MIRT1228389	hsa-miR-3140-5p	CLIP-seq
MIRT1228390	hsa-miR-3141	CLIP-seq
MIRT1228391	hsa-miR-3160-5p	CLIP-seq
MIRT1228392	hsa-miR-3162-5p	CLIP-seq
MIRT1228393	hsa-miR-3165	CLIP-seq
MIRT1228394	hsa-miR-3167	CLIP-seq
MIRT1228395	hsa-miR-3170	CLIP-seq
MIRT1228396	hsa-miR-3179	CLIP-seq
MIRT1228397	hsa-miR-3185	CLIP-seq
MIRT1228398	hsa-miR-3188	CLIP-seq
MIRT1228399	hsa-miR-338-5p	CLIP-seq
MIRT1228400	hsa-miR-342-3p	CLIP-seq
MIRT1228401	hsa-miR-3591-5p	CLIP-seq
MIRT1228402	hsa-miR-3607-3p	CLIP-seq
MIRT1228403	hsa-miR-3612	CLIP-seq
MIRT1228404	hsa-miR-3613-3p	CLIP-seq
MIRT1228405	hsa-miR-3618	CLIP-seq
MIRT1228406	hsa-miR-3646	CLIP-seq
MIRT1228407	hsa-miR-3649	CLIP-seq
MIRT1228408	hsa-miR-3658	CLIP-seq
MIRT1228409	hsa-miR-3661	CLIP-seq
MIRT1228410	hsa-miR-3662	CLIP-seq
MIRT1228411	hsa-miR-3668	CLIP-seq
MIRT1228412	hsa-miR-3673	CLIP-seq
MIRT1228413	hsa-miR-3674	CLIP-seq
MIRT1228414	hsa-miR-3684	CLIP-seq
MIRT1228415	hsa-miR-3689a-3p	CLIP-seq
MIRT1228416	hsa-miR-3689c	CLIP-seq
MIRT1228417	hsa-miR-3690	CLIP-seq
MIRT1228418	hsa-miR-3691-5p	CLIP-seq
MIRT1228419	hsa-miR-371b-5p	CLIP-seq
MIRT1228420	hsa-miR-377	CLIP-seq
MIRT1228421	hsa-miR-378	CLIP-seq
MIRT1228422	hsa-miR-378b	CLIP-seq
MIRT1228423	hsa-miR-378c	CLIP-seq
MIRT1228424	hsa-miR-378d	CLIP-seq
MIRT1228425	hsa-miR-378e	CLIP-seq
MIRT1228426	hsa-miR-378f	CLIP-seq
MIRT1228427	hsa-miR-378h	CLIP-seq
MIRT1228428	hsa-miR-378i	CLIP-seq
MIRT1228429	hsa-miR-3910	CLIP-seq
MIRT1228430	hsa-miR-3913-5p	CLIP-seq
MIRT1228431	hsa-miR-3925-5p	CLIP-seq
MIRT1228432	hsa-miR-3927	CLIP-seq
MIRT1228433	hsa-miR-3938	CLIP-seq
MIRT1228434	hsa-miR-3974	CLIP-seq
MIRT1228435	hsa-miR-422a	CLIP-seq
MIRT1228436	hsa-miR-4251	CLIP-seq
MIRT1228437	hsa-miR-4257	CLIP-seq
MIRT1228438	hsa-miR-4262	CLIP-seq
MIRT1228439	hsa-miR-4272	CLIP-seq
MIRT1228440	hsa-miR-4279	CLIP-seq
MIRT1228441	hsa-miR-4303	CLIP-seq
MIRT1228442	hsa-miR-4310	CLIP-seq
MIRT1228443	hsa-miR-4319	CLIP-seq
MIRT1228444	hsa-miR-4327	CLIP-seq
MIRT1228445	hsa-miR-4328	CLIP-seq
MIRT1228446	hsa-miR-4329	CLIP-seq
MIRT1228447	hsa-miR-4443	CLIP-seq
MIRT1228448	hsa-miR-4452	CLIP-seq
MIRT1228449	hsa-miR-4453	CLIP-seq
MIRT1228450	hsa-miR-4458	CLIP-seq
MIRT1228451	hsa-miR-4477b	CLIP-seq
MIRT1228452	hsa-miR-4481	CLIP-seq
MIRT1228453	hsa-miR-4500	CLIP-seq
MIRT1228454	hsa-miR-4503	CLIP-seq
MIRT1228455	hsa-miR-4520a-3p	CLIP-seq
MIRT1228456	hsa-miR-4520b-3p	CLIP-seq
MIRT1228457	hsa-miR-4538	CLIP-seq
MIRT1228458	hsa-miR-4539	CLIP-seq
MIRT1228459	hsa-miR-4633-5p	CLIP-seq
MIRT1228460	hsa-miR-4639-3p	CLIP-seq
MIRT1228461	hsa-miR-4642	CLIP-seq
MIRT1228462	hsa-miR-4659a-3p	CLIP-seq
MIRT1228463	hsa-miR-4659a-5p	CLIP-seq
MIRT1228464	hsa-miR-4659b-3p	CLIP-seq
MIRT1228465	hsa-miR-4659b-5p	CLIP-seq
MIRT1228466	hsa-miR-4667-3p	CLIP-seq
MIRT1228467	hsa-miR-4668-3p	CLIP-seq
MIRT1228468	hsa-miR-4680-5p	CLIP-seq
MIRT1228469	hsa-miR-4688	CLIP-seq
MIRT1228470	hsa-miR-4698	CLIP-seq
MIRT1228471	hsa-miR-4699-3p	CLIP-seq
MIRT1228472	hsa-miR-4703-3p	CLIP-seq
MIRT1228473	hsa-miR-4717-5p	CLIP-seq
MIRT1228474	hsa-miR-4727-5p	CLIP-seq
MIRT1228475	hsa-miR-4732-3p	CLIP-seq
MIRT1228476	hsa-miR-4735-5p	CLIP-seq
MIRT1228477	hsa-miR-4745-5p	CLIP-seq
MIRT1228478	hsa-miR-4752	CLIP-seq
MIRT1228479	hsa-miR-4753-3p	CLIP-seq
MIRT1228480	hsa-miR-4753-5p	CLIP-seq
MIRT1228481	hsa-miR-4758-5p	CLIP-seq
MIRT1228482	hsa-miR-4761-5p	CLIP-seq
MIRT1228483	hsa-miR-4764-5p	CLIP-seq
MIRT1228484	hsa-miR-4769-3p	CLIP-seq
MIRT1228485	hsa-miR-4772-3p	CLIP-seq
MIRT1228486	hsa-miR-4778-3p	CLIP-seq
MIRT1228487	hsa-miR-4799-5p	CLIP-seq
MIRT1228488	hsa-miR-486-5p	CLIP-seq
MIRT1228489	hsa-miR-487a	CLIP-seq
MIRT1228490	hsa-miR-489	CLIP-seq
MIRT1228491	hsa-miR-491-3p	CLIP-seq
MIRT1228492	hsa-miR-5095	CLIP-seq
MIRT1228493	hsa-miR-513a-3p	CLIP-seq
MIRT1228494	hsa-miR-518a-5p	CLIP-seq
MIRT1228495	hsa-miR-527	CLIP-seq
MIRT1228496	hsa-miR-539	CLIP-seq
MIRT1228497	hsa-miR-543	CLIP-seq
MIRT1228498	hsa-miR-548ac	CLIP-seq
MIRT1228499	hsa-miR-548ae	CLIP-seq
MIRT1228500	hsa-miR-548aj	CLIP-seq
MIRT1228501	hsa-miR-548am	CLIP-seq
MIRT1228502	hsa-miR-548c-3p	CLIP-seq
MIRT1228503	hsa-miR-548d-3p	CLIP-seq
MIRT1228504	hsa-miR-548g	CLIP-seq
MIRT1228505	hsa-miR-548m	CLIP-seq
MIRT1228506	hsa-miR-548x	CLIP-seq
MIRT1228507	hsa-miR-548z	CLIP-seq
MIRT1228508	hsa-miR-552	CLIP-seq
MIRT1228509	hsa-miR-563	CLIP-seq
MIRT1228510	hsa-miR-570	CLIP-seq
MIRT1228511	hsa-miR-576-5p	CLIP-seq
MIRT1228512	hsa-miR-578	CLIP-seq
MIRT1228513	hsa-miR-579	CLIP-seq
MIRT1228514	hsa-miR-581	CLIP-seq
MIRT1228515	hsa-miR-587	CLIP-seq
MIRT1228516	hsa-miR-590-3p	CLIP-seq
MIRT1228517	hsa-miR-592	CLIP-seq
MIRT1228518	hsa-miR-597	CLIP-seq
MIRT1228519	hsa-miR-599	CLIP-seq
MIRT1228520	hsa-miR-619	CLIP-seq
MIRT1228521	hsa-miR-624	CLIP-seq
MIRT1228522	hsa-miR-631	CLIP-seq
MIRT1228523	hsa-miR-635	CLIP-seq
MIRT1228524	hsa-miR-640	CLIP-seq
MIRT1228525	hsa-miR-648	CLIP-seq
MIRT1228526	hsa-miR-650	CLIP-seq
MIRT1228527	hsa-miR-653	CLIP-seq
MIRT1228528	hsa-miR-659	CLIP-seq
MIRT1228529	hsa-miR-664	CLIP-seq
MIRT1228530	hsa-miR-668	CLIP-seq
MIRT1228531	hsa-miR-670	CLIP-seq
MIRT1228532	hsa-miR-7	CLIP-seq
MIRT1228533	hsa-miR-876-5p	CLIP-seq
MIRT1228534	hsa-miR-885-3p	CLIP-seq
MIRT1228535	hsa-miR-885-5p	CLIP-seq
MIRT1228536	hsa-miR-888	CLIP-seq
MIRT1228537	hsa-miR-934	CLIP-seq
MIRT1228538	hsa-miR-942	CLIP-seq
MIRT1228539	hsa-miR-96	CLIP-seq
MIRT1228540	hsa-miR-98	CLIP-seq
MIRT1228338	hsa-let-7a	CLIP-seq
MIRT1228339	hsa-let-7b	CLIP-seq
MIRT1228340	hsa-let-7c	CLIP-seq
MIRT1228341	hsa-let-7d	CLIP-seq
MIRT1228342	hsa-let-7e	CLIP-seq
MIRT1228343	hsa-let-7f	CLIP-seq
MIRT1228344	hsa-let-7g	CLIP-seq
MIRT1228345	hsa-let-7i	CLIP-seq
MIRT1228350	hsa-miR-1236	CLIP-seq
MIRT2066817	hsa-miR-1245b-3p	CLIP-seq
MIRT2066818	hsa-miR-1248	CLIP-seq
MIRT2066819	hsa-miR-1252	CLIP-seq
MIRT1228358	hsa-miR-1279	CLIP-seq
MIRT2066820	hsa-miR-128	CLIP-seq
MIRT1228362	hsa-miR-1298	CLIP-seq
MIRT2066821	hsa-miR-1305	CLIP-seq
MIRT1228365	hsa-miR-1324	CLIP-seq
MIRT2066822	hsa-miR-135a	CLIP-seq
MIRT2066823	hsa-miR-135b	CLIP-seq
MIRT2066824	hsa-miR-140-3p	CLIP-seq
MIRT1228366	hsa-miR-1470	CLIP-seq
MIRT1228371	hsa-miR-182	CLIP-seq
MIRT2066825	hsa-miR-1825	CLIP-seq
MIRT2066826	hsa-miR-1827	CLIP-seq
MIRT2066827	hsa-miR-186	CLIP-seq
MIRT2066828	hsa-miR-1910	CLIP-seq
MIRT2066829	hsa-miR-1976	CLIP-seq
MIRT2066830	hsa-miR-204	CLIP-seq
MIRT2066831	hsa-miR-211	CLIP-seq
MIRT2066832	hsa-miR-216b	CLIP-seq
MIRT2066833	hsa-miR-223	CLIP-seq
MIRT2066834	hsa-miR-3065-3p	CLIP-seq
MIRT1228378	hsa-miR-3074-5p	CLIP-seq
MIRT2066835	hsa-miR-3115	CLIP-seq
MIRT2066836	hsa-miR-3117-3p	CLIP-seq
MIRT2066837	hsa-miR-3124-3p	CLIP-seq
MIRT2066838	hsa-miR-3140-3p	CLIP-seq
MIRT2066839	hsa-miR-3143	CLIP-seq
MIRT2066840	hsa-miR-3144-5p	CLIP-seq
MIRT2066841	hsa-miR-3148	CLIP-seq
MIRT2066842	hsa-miR-3154	CLIP-seq
MIRT2066843	hsa-miR-3158-5p	CLIP-seq
MIRT2066844	hsa-miR-3161	CLIP-seq
MIRT2066845	hsa-miR-3163	CLIP-seq
MIRT2066846	hsa-miR-3169	CLIP-seq
MIRT2066847	hsa-miR-3173-3p	CLIP-seq
MIRT1228396	hsa-miR-3179	CLIP-seq
MIRT2066848	hsa-miR-3183	CLIP-seq
MIRT2066849	hsa-miR-3191	CLIP-seq
MIRT1228400	hsa-miR-342-3p	CLIP-seq
MIRT1228403	hsa-miR-3612	CLIP-seq
MIRT1228404	hsa-miR-3613-3p	CLIP-seq
MIRT2066850	hsa-miR-361-5p	CLIP-seq
MIRT2066851	hsa-miR-3647-3p	CLIP-seq
MIRT2066852	hsa-miR-3654	CLIP-seq
MIRT1228412	hsa-miR-3673	CLIP-seq
MIRT2066853	hsa-miR-3689d	CLIP-seq
MIRT2066854	hsa-miR-370	CLIP-seq
MIRT1228419	hsa-miR-371b-5p	CLIP-seq
MIRT1228420	hsa-miR-377	CLIP-seq
MIRT2066855	hsa-miR-3919	CLIP-seq
MIRT1228432	hsa-miR-3927	CLIP-seq
MIRT2066856	hsa-miR-409-3p	CLIP-seq
MIRT1228436	hsa-miR-4251	CLIP-seq
MIRT1228437	hsa-miR-4257	CLIP-seq
MIRT2066857	hsa-miR-4264	CLIP-seq
MIRT2066858	hsa-miR-4269	CLIP-seq
MIRT2066859	hsa-miR-4277	CLIP-seq
MIRT1228440	hsa-miR-4279	CLIP-seq
MIRT2066860	hsa-miR-4282	CLIP-seq
MIRT2066861	hsa-miR-4287	CLIP-seq
MIRT2066862	hsa-miR-4291	CLIP-seq
MIRT1228441	hsa-miR-4303	CLIP-seq
MIRT2066863	hsa-miR-4326	CLIP-seq
MIRT1228445	hsa-miR-4328	CLIP-seq
MIRT1228446	hsa-miR-4329	CLIP-seq
MIRT2066864	hsa-miR-4436b-5p	CLIP-seq
MIRT1228447	hsa-miR-4443	CLIP-seq
MIRT2066865	hsa-miR-4445	CLIP-seq
MIRT1228450	hsa-miR-4458	CLIP-seq
MIRT2066866	hsa-miR-4469	CLIP-seq
MIRT2066867	hsa-miR-4470	CLIP-seq
MIRT2066868	hsa-miR-4477a	CLIP-seq
MIRT1228451	hsa-miR-4477b	CLIP-seq
MIRT1228453	hsa-miR-4500	CLIP-seq
MIRT2066869	hsa-miR-4509	CLIP-seq
MIRT2066870	hsa-miR-450b-5p	CLIP-seq
MIRT2066871	hsa-miR-4514	CLIP-seq
MIRT1228456	hsa-miR-4520b-3p	CLIP-seq
MIRT2066872	hsa-miR-4528	CLIP-seq
MIRT2066873	hsa-miR-4529-3p	CLIP-seq
MIRT2066874	hsa-miR-4535	CLIP-seq
MIRT1228460	hsa-miR-4639-3p	CLIP-seq
MIRT2066875	hsa-miR-4643	CLIP-seq
MIRT2066876	hsa-miR-4652-5p	CLIP-seq
MIRT1228462	hsa-miR-4659a-3p	CLIP-seq
MIRT1228464	hsa-miR-4659b-3p	CLIP-seq
MIRT1228466	hsa-miR-4667-3p	CLIP-seq
MIRT2066877	hsa-miR-4670-3p	CLIP-seq
MIRT2066878	hsa-miR-4685-3p	CLIP-seq
MIRT2066879	hsa-miR-4691-5p	CLIP-seq
MIRT2066880	hsa-miR-4692	CLIP-seq
MIRT2066881	hsa-miR-4694-3p	CLIP-seq
MIRT2066882	hsa-miR-4694-5p	CLIP-seq
MIRT2066883	hsa-miR-4697-3p	CLIP-seq
MIRT2066884	hsa-miR-4704-3p	CLIP-seq
MIRT2066885	hsa-miR-4709-3p	CLIP-seq
MIRT2066886	hsa-miR-4717-3p	CLIP-seq
MIRT2066887	hsa-miR-4723-3p	CLIP-seq
MIRT2066888	hsa-miR-4742-5p	CLIP-seq
MIRT2066889	hsa-miR-4744	CLIP-seq
MIRT2066890	hsa-miR-4755-3p	CLIP-seq
MIRT2066891	hsa-miR-4759	CLIP-seq
MIRT2066892	hsa-miR-4766-3p	CLIP-seq
MIRT2066893	hsa-miR-4766-5p	CLIP-seq
MIRT2066894	hsa-miR-4768-3p	CLIP-seq
MIRT2066895	hsa-miR-4768-5p	CLIP-seq
MIRT2066896	hsa-miR-4789-3p	CLIP-seq
MIRT2066897	hsa-miR-4797-3p	CLIP-seq
MIRT1228487	hsa-miR-4799-5p	CLIP-seq
MIRT2066898	hsa-miR-4802-3p	CLIP-seq
MIRT2066899	hsa-miR-4803	CLIP-seq
MIRT2066900	hsa-miR-488	CLIP-seq
MIRT2066901	hsa-miR-490-5p	CLIP-seq
MIRT2066902	hsa-miR-491-5p	CLIP-seq
MIRT2066903	hsa-miR-492	CLIP-seq
MIRT2066904	hsa-miR-507	CLIP-seq
MIRT2066905	hsa-miR-5096	CLIP-seq
MIRT2066906	hsa-miR-522	CLIP-seq
MIRT2066907	hsa-miR-545	CLIP-seq
MIRT1228498	hsa-miR-548ac	CLIP-seq
MIRT1228503	hsa-miR-548d-3p	CLIP-seq
MIRT1228505	hsa-miR-548m	CLIP-seq
MIRT2066908	hsa-miR-548p	CLIP-seq
MIRT1228507	hsa-miR-548z	CLIP-seq
MIRT2066909	hsa-miR-557	CLIP-seq
MIRT2066910	hsa-miR-561	CLIP-seq
MIRT2066911	hsa-miR-577	CLIP-seq
MIRT2066912	hsa-miR-582-5p	CLIP-seq
MIRT1228518	hsa-miR-597	CLIP-seq
MIRT1228519	hsa-miR-599	CLIP-seq
MIRT2066913	hsa-miR-642b	CLIP-seq
MIRT1228526	hsa-miR-650	CLIP-seq
MIRT2066914	hsa-miR-665	CLIP-seq
MIRT1228530	hsa-miR-668	CLIP-seq
MIRT2066915	hsa-miR-889	CLIP-seq
MIRT2066916	hsa-miR-935	CLIP-seq
MIRT2066917	hsa-miR-940	CLIP-seq
MIRT1228538	hsa-miR-942	CLIP-seq
MIRT1228540	hsa-miR-98	CLIP-seq
MIRT1228361	hsa-miR-129-5p	CLIP-seq
MIRT2294410	hsa-miR-1299	CLIP-seq
MIRT1228367	hsa-miR-181a	CLIP-seq
MIRT1228368	hsa-miR-181b	CLIP-seq
MIRT1228369	hsa-miR-181c	CLIP-seq
MIRT1228370	hsa-miR-181d	CLIP-seq
MIRT2066832	hsa-miR-216b	CLIP-seq
MIRT1228374	hsa-miR-219-2-3p	CLIP-seq
MIRT2066836	hsa-miR-3117-3p	CLIP-seq
MIRT1228391	hsa-miR-3160-5p	CLIP-seq
MIRT2294411	hsa-miR-3192	CLIP-seq
MIRT2294412	hsa-miR-3199	CLIP-seq
MIRT1228410	hsa-miR-3662	CLIP-seq
MIRT2294413	hsa-miR-421	CLIP-seq
MIRT1228438	hsa-miR-4262	CLIP-seq
MIRT2066860	hsa-miR-4282	CLIP-seq
MIRT2294414	hsa-miR-4301	CLIP-seq
MIRT1228442	hsa-miR-4310	CLIP-seq
MIRT2294415	hsa-miR-4314	CLIP-seq
MIRT2294416	hsa-miR-4421	CLIP-seq
MIRT2294417	hsa-miR-4646-5p	CLIP-seq
MIRT1228462	hsa-miR-4659a-3p	CLIP-seq
MIRT1228464	hsa-miR-4659b-3p	CLIP-seq
MIRT2294418	hsa-miR-4668-5p	CLIP-seq
MIRT2294419	hsa-miR-4676-5p	CLIP-seq
MIRT1228480	hsa-miR-4753-5p	CLIP-seq
MIRT2066895	hsa-miR-4768-5p	CLIP-seq
MIRT2294420	hsa-miR-4795-3p	CLIP-seq
MIRT2066905	hsa-miR-5096	CLIP-seq
MIRT2294421	hsa-miR-575	CLIP-seq
MIRT1228512	hsa-miR-578	CLIP-seq
MIRT2294422	hsa-miR-875-3p	CLIP-seq
MIRT1228338	hsa-let-7a	CLIP-seq
MIRT1228339	hsa-let-7b	CLIP-seq
MIRT1228340	hsa-let-7c	CLIP-seq
MIRT1228341	hsa-let-7d	CLIP-seq
MIRT1228342	hsa-let-7e	CLIP-seq
MIRT1228343	hsa-let-7f	CLIP-seq
MIRT1228344	hsa-let-7g	CLIP-seq
MIRT1228345	hsa-let-7i	CLIP-seq
MIRT2294423	hsa-miR-1	CLIP-seq
MIRT2294424	hsa-miR-100	CLIP-seq
MIRT2294425	hsa-miR-101	CLIP-seq
MIRT2294426	hsa-miR-105	CLIP-seq
MIRT1228347	hsa-miR-1179	CLIP-seq
MIRT2294427	hsa-miR-1197	CLIP-seq
MIRT1228348	hsa-miR-1200	CLIP-seq
MIRT2294428	hsa-miR-1226	CLIP-seq
MIRT2294429	hsa-miR-1229	CLIP-seq
MIRT1228350	hsa-miR-1236	CLIP-seq
MIRT2294430	hsa-miR-1243	CLIP-seq
MIRT2066817	hsa-miR-1245b-3p	CLIP-seq
MIRT2294431	hsa-miR-1253	CLIP-seq
MIRT1228351	hsa-miR-1257	CLIP-seq
MIRT1228354	hsa-miR-1261	CLIP-seq
MIRT2294432	hsa-miR-1269	CLIP-seq
MIRT2294433	hsa-miR-1269b	CLIP-seq
MIRT2294434	hsa-miR-1272	CLIP-seq
MIRT2294435	hsa-miR-1276	CLIP-seq
MIRT1228358	hsa-miR-1279	CLIP-seq
MIRT2066820	hsa-miR-128	CLIP-seq
MIRT1228359	hsa-miR-1283	CLIP-seq
MIRT2294436	hsa-miR-1288	CLIP-seq
MIRT2294437	hsa-miR-1297	CLIP-seq
MIRT1228362	hsa-miR-1298	CLIP-seq
MIRT2294410	hsa-miR-1299	CLIP-seq
MIRT1228363	hsa-miR-1303	CLIP-seq
MIRT2066821	hsa-miR-1305	CLIP-seq
MIRT2294438	hsa-miR-132	CLIP-seq
MIRT2294439	hsa-miR-1322	CLIP-seq
MIRT2294440	hsa-miR-134	CLIP-seq
MIRT2066822	hsa-miR-135a	CLIP-seq
MIRT2066823	hsa-miR-135b	CLIP-seq
MIRT2294441	hsa-miR-141	CLIP-seq
MIRT2294442	hsa-miR-146a	CLIP-seq
MIRT2294443	hsa-miR-146b-5p	CLIP-seq
MIRT2294444	hsa-miR-151-3p	CLIP-seq
MIRT2294445	hsa-miR-155	CLIP-seq
MIRT1228367	hsa-miR-181a	CLIP-seq
MIRT1228368	hsa-miR-181b	CLIP-seq
MIRT1228369	hsa-miR-181c	CLIP-seq
MIRT1228370	hsa-miR-181d	CLIP-seq
MIRT2066825	hsa-miR-1825	CLIP-seq
MIRT2066826	hsa-miR-1827	CLIP-seq
MIRT2294446	hsa-miR-185	CLIP-seq
MIRT2294447	hsa-miR-190	CLIP-seq
MIRT2294448	hsa-miR-190b	CLIP-seq
MIRT2066828	hsa-miR-1910	CLIP-seq
MIRT2294449	hsa-miR-1915	CLIP-seq
MIRT2294450	hsa-miR-19a	CLIP-seq
MIRT2294451	hsa-miR-19b	CLIP-seq
MIRT2294452	hsa-miR-200a	CLIP-seq
MIRT2294453	hsa-miR-202	CLIP-seq
MIRT2294454	hsa-miR-2052	CLIP-seq
MIRT2294455	hsa-miR-206	CLIP-seq
MIRT2294456	hsa-miR-2113	CLIP-seq
MIRT2294457	hsa-miR-212	CLIP-seq
MIRT2294458	hsa-miR-214	CLIP-seq
MIRT2294459	hsa-miR-216a	CLIP-seq
MIRT2066832	hsa-miR-216b	CLIP-seq
MIRT1228373	hsa-miR-218	CLIP-seq
MIRT2066833	hsa-miR-223	CLIP-seq
MIRT2294460	hsa-miR-224	CLIP-seq
MIRT2294461	hsa-miR-2278	CLIP-seq
MIRT2294462	hsa-miR-2467-3p	CLIP-seq
MIRT2294463	hsa-miR-26a	CLIP-seq
MIRT2294464	hsa-miR-26b	CLIP-seq
MIRT2294465	hsa-miR-27a	CLIP-seq
MIRT2294466	hsa-miR-27b	CLIP-seq
MIRT2294467	hsa-miR-2861	CLIP-seq
MIRT2294468	hsa-miR-3064-3p	CLIP-seq
MIRT1228378	hsa-miR-3074-5p	CLIP-seq
MIRT2066836	hsa-miR-3117-3p	CLIP-seq
MIRT2294469	hsa-miR-3117-5p	CLIP-seq
MIRT2294470	hsa-miR-3118	CLIP-seq
MIRT2294471	hsa-miR-3119	CLIP-seq
MIRT1228384	hsa-miR-3120-3p	CLIP-seq
MIRT1228385	hsa-miR-3121-3p	CLIP-seq
MIRT2066837	hsa-miR-3124-3p	CLIP-seq
MIRT2294472	hsa-miR-3135	CLIP-seq
MIRT2066838	hsa-miR-3140-3p	CLIP-seq
MIRT2066839	hsa-miR-3143	CLIP-seq
MIRT2294473	hsa-miR-3144-3p	CLIP-seq
MIRT2066841	hsa-miR-3148	CLIP-seq
MIRT2294474	hsa-miR-3153	CLIP-seq
MIRT2066843	hsa-miR-3158-5p	CLIP-seq
MIRT1228391	hsa-miR-3160-5p	CLIP-seq
MIRT1228393	hsa-miR-3165	CLIP-seq
MIRT2066847	hsa-miR-3173-3p	CLIP-seq
MIRT2294475	hsa-miR-3178	CLIP-seq
MIRT2294476	hsa-miR-3180-5p	CLIP-seq
MIRT2294477	hsa-miR-3182	CLIP-seq
MIRT1228398	hsa-miR-3188	CLIP-seq
MIRT2294411	hsa-miR-3192	CLIP-seq
MIRT2294412	hsa-miR-3199	CLIP-seq
MIRT2294478	hsa-miR-330-3p	CLIP-seq
MIRT2294479	hsa-miR-335	CLIP-seq
MIRT2294480	hsa-miR-337-3p	CLIP-seq
MIRT2294481	hsa-miR-338-3p	CLIP-seq
MIRT1228399	hsa-miR-338-5p	CLIP-seq
MIRT1228400	hsa-miR-342-3p	CLIP-seq
MIRT1228401	hsa-miR-3591-5p	CLIP-seq
MIRT1228403	hsa-miR-3612	CLIP-seq
MIRT2294482	hsa-miR-3614-5p	CLIP-seq
MIRT2066850	hsa-miR-361-5p	CLIP-seq
MIRT1228405	hsa-miR-3618	CLIP-seq
MIRT2294483	hsa-miR-3619-5p	CLIP-seq
MIRT2294484	hsa-miR-3620	CLIP-seq
MIRT1228406	hsa-miR-3646	CLIP-seq
MIRT2066851	hsa-miR-3647-3p	CLIP-seq
MIRT2294485	hsa-miR-365	CLIP-seq
MIRT2066852	hsa-miR-3654	CLIP-seq
MIRT1228409	hsa-miR-3661	CLIP-seq
MIRT1228410	hsa-miR-3662	CLIP-seq
MIRT2294486	hsa-miR-3678-3p	CLIP-seq
MIRT2294487	hsa-miR-3682-3p	CLIP-seq
MIRT1228414	hsa-miR-3684	CLIP-seq
MIRT2066853	hsa-miR-3689d	CLIP-seq
MIRT1228417	hsa-miR-3690	CLIP-seq
MIRT1228418	hsa-miR-3691-5p	CLIP-seq
MIRT2294488	hsa-miR-3714	CLIP-seq
MIRT2294489	hsa-miR-371b-3p	CLIP-seq
MIRT1228419	hsa-miR-371b-5p	CLIP-seq
MIRT1228420	hsa-miR-377	CLIP-seq
MIRT1228421	hsa-miR-378	CLIP-seq
MIRT1228422	hsa-miR-378b	CLIP-seq
MIRT1228423	hsa-miR-378c	CLIP-seq
MIRT1228424	hsa-miR-378d	CLIP-seq
MIRT1228425	hsa-miR-378e	CLIP-seq
MIRT1228426	hsa-miR-378f	CLIP-seq
MIRT1228427	hsa-miR-378h	CLIP-seq
MIRT1228428	hsa-miR-378i	CLIP-seq
MIRT2294490	hsa-miR-380	CLIP-seq
MIRT2294491	hsa-miR-3915	CLIP-seq
MIRT2294492	hsa-miR-3918	CLIP-seq
MIRT2066855	hsa-miR-3919	CLIP-seq
MIRT2294493	hsa-miR-3920	CLIP-seq
MIRT2294494	hsa-miR-3924	CLIP-seq
MIRT1228432	hsa-miR-3927	CLIP-seq
MIRT2294495	hsa-miR-3928	CLIP-seq
MIRT2294496	hsa-miR-3973	CLIP-seq
MIRT2294413	hsa-miR-421	CLIP-seq
MIRT1228435	hsa-miR-422a	CLIP-seq
MIRT1228436	hsa-miR-4251	CLIP-seq
MIRT1228437	hsa-miR-4257	CLIP-seq
MIRT1228438	hsa-miR-4262	CLIP-seq
MIRT2066858	hsa-miR-4269	CLIP-seq
MIRT2066862	hsa-miR-4291	CLIP-seq
MIRT2294414	hsa-miR-4301	CLIP-seq
MIRT1228441	hsa-miR-4303	CLIP-seq
MIRT2294497	hsa-miR-4305	CLIP-seq
MIRT2294498	hsa-miR-4306	CLIP-seq
MIRT1228442	hsa-miR-4310	CLIP-seq
MIRT2294415	hsa-miR-4314	CLIP-seq
MIRT2294499	hsa-miR-4323	CLIP-seq
MIRT2066863	hsa-miR-4326	CLIP-seq
MIRT1228445	hsa-miR-4328	CLIP-seq
MIRT1228446	hsa-miR-4329	CLIP-seq
MIRT2294500	hsa-miR-4418	CLIP-seq
MIRT2294416	hsa-miR-4421	CLIP-seq
MIRT2294501	hsa-miR-4424	CLIP-seq
MIRT2294502	hsa-miR-4428	CLIP-seq
MIRT2294503	hsa-miR-4434	CLIP-seq
MIRT2294504	hsa-miR-4436a	CLIP-seq
MIRT2066864	hsa-miR-4436b-5p	CLIP-seq
MIRT1228447	hsa-miR-4443	CLIP-seq
MIRT1228449	hsa-miR-4453	CLIP-seq
MIRT1228450	hsa-miR-4458	CLIP-seq
MIRT2294505	hsa-miR-4465	CLIP-seq
MIRT2294506	hsa-miR-4476	CLIP-seq
MIRT2066868	hsa-miR-4477a	CLIP-seq
MIRT2294507	hsa-miR-4480	CLIP-seq
MIRT2294508	hsa-miR-4484	CLIP-seq
MIRT2294509	hsa-miR-4487	CLIP-seq
MIRT2294510	hsa-miR-4490	CLIP-seq
MIRT2294511	hsa-miR-4495	CLIP-seq
MIRT1228453	hsa-miR-4500	CLIP-seq
MIRT2066870	hsa-miR-450b-5p	CLIP-seq
MIRT2066871	hsa-miR-4514	CLIP-seq
MIRT2294512	hsa-miR-4515	CLIP-seq
MIRT2294513	hsa-miR-4516	CLIP-seq
MIRT2294514	hsa-miR-451b	CLIP-seq
MIRT1228455	hsa-miR-4520a-3p	CLIP-seq
MIRT1228456	hsa-miR-4520b-3p	CLIP-seq
MIRT2066872	hsa-miR-4528	CLIP-seq
MIRT2294515	hsa-miR-4530	CLIP-seq
MIRT1228457	hsa-miR-4538	CLIP-seq
MIRT2294516	hsa-miR-455-3p	CLIP-seq
MIRT2294517	hsa-miR-4637	CLIP-seq
MIRT1228460	hsa-miR-4639-3p	CLIP-seq
MIRT2294518	hsa-miR-4639-5p	CLIP-seq
MIRT2294519	hsa-miR-4640-5p	CLIP-seq
MIRT2294520	hsa-miR-4641	CLIP-seq
MIRT2066875	hsa-miR-4643	CLIP-seq
MIRT2294521	hsa-miR-4644	CLIP-seq
MIRT2294522	hsa-miR-4645-5p	CLIP-seq
MIRT2294417	hsa-miR-4646-5p	CLIP-seq
MIRT2294523	hsa-miR-4649-3p	CLIP-seq
MIRT1228462	hsa-miR-4659a-3p	CLIP-seq
MIRT1228464	hsa-miR-4659b-3p	CLIP-seq
MIRT2294418	hsa-miR-4668-5p	CLIP-seq
MIRT2294524	hsa-miR-4672	CLIP-seq
MIRT2294525	hsa-miR-4673	CLIP-seq
MIRT2294419	hsa-miR-4676-5p	CLIP-seq
MIRT2294526	hsa-miR-4681	CLIP-seq
MIRT2066879	hsa-miR-4691-5p	CLIP-seq
MIRT2066880	hsa-miR-4692	CLIP-seq
MIRT2066882	hsa-miR-4694-5p	CLIP-seq
MIRT2294527	hsa-miR-4695-3p	CLIP-seq
MIRT2294528	hsa-miR-4704-5p	CLIP-seq
MIRT2066885	hsa-miR-4709-3p	CLIP-seq
MIRT2294529	hsa-miR-4709-5p	CLIP-seq
MIRT2066886	hsa-miR-4717-3p	CLIP-seq
MIRT1228473	hsa-miR-4717-5p	CLIP-seq
MIRT2294530	hsa-miR-4719	CLIP-seq
MIRT2294531	hsa-miR-4720-3p	CLIP-seq
MIRT2294532	hsa-miR-4726-3p	CLIP-seq
MIRT2294533	hsa-miR-4726-5p	CLIP-seq
MIRT2294534	hsa-miR-4736	CLIP-seq
MIRT2294535	hsa-miR-4740-5p	CLIP-seq
MIRT2066888	hsa-miR-4742-5p	CLIP-seq
MIRT1228478	hsa-miR-4752	CLIP-seq
MIRT1228479	hsa-miR-4753-3p	CLIP-seq
MIRT2294536	hsa-miR-4754	CLIP-seq
MIRT2066890	hsa-miR-4755-3p	CLIP-seq
MIRT2294537	hsa-miR-4756-3p	CLIP-seq
MIRT1228481	hsa-miR-4758-5p	CLIP-seq
MIRT1228482	hsa-miR-4761-5p	CLIP-seq
MIRT2294538	hsa-miR-4762-3p	CLIP-seq
MIRT2066894	hsa-miR-4768-3p	CLIP-seq
MIRT2066895	hsa-miR-4768-5p	CLIP-seq
MIRT1228485	hsa-miR-4772-3p	CLIP-seq
MIRT1228486	hsa-miR-4778-3p	CLIP-seq
MIRT2066896	hsa-miR-4789-3p	CLIP-seq
MIRT1228487	hsa-miR-4799-5p	CLIP-seq
MIRT2066898	hsa-miR-4802-3p	CLIP-seq
MIRT2294539	hsa-miR-4802-5p	CLIP-seq
MIRT2066899	hsa-miR-4803	CLIP-seq
MIRT2294540	hsa-miR-4804-3p	CLIP-seq
MIRT2294541	hsa-miR-483-5p	CLIP-seq
MIRT1228488	hsa-miR-486-5p	CLIP-seq
MIRT2066900	hsa-miR-488	CLIP-seq
MIRT2294542	hsa-miR-490-3p	CLIP-seq
MIRT2066901	hsa-miR-490-5p	CLIP-seq
MIRT2294543	hsa-miR-505	CLIP-seq
MIRT2066904	hsa-miR-507	CLIP-seq
MIRT2294544	hsa-miR-509-3-5p	CLIP-seq
MIRT2294545	hsa-miR-509-5p	CLIP-seq
MIRT2294546	hsa-miR-513a-5p	CLIP-seq
MIRT2294547	hsa-miR-514	CLIP-seq
MIRT2294548	hsa-miR-514b-3p	CLIP-seq
MIRT2294549	hsa-miR-520a-5p	CLIP-seq
MIRT2294550	hsa-miR-520d-5p	CLIP-seq
MIRT2066906	hsa-miR-522	CLIP-seq
MIRT2294551	hsa-miR-524-5p	CLIP-seq
MIRT2294552	hsa-miR-525-5p	CLIP-seq
MIRT1228496	hsa-miR-539	CLIP-seq
MIRT1228497	hsa-miR-543	CLIP-seq
MIRT2066907	hsa-miR-545	CLIP-seq
MIRT2294553	hsa-miR-548an	CLIP-seq
MIRT1228502	hsa-miR-548c-3p	CLIP-seq
MIRT1228505	hsa-miR-548m	CLIP-seq
MIRT2294554	hsa-miR-554	CLIP-seq
MIRT2066909	hsa-miR-557	CLIP-seq
MIRT2066910	hsa-miR-561	CLIP-seq
MIRT2294421	hsa-miR-575	CLIP-seq
MIRT1228512	hsa-miR-578	CLIP-seq
MIRT1228513	hsa-miR-579	CLIP-seq
MIRT2294555	hsa-miR-580	CLIP-seq
MIRT1228514	hsa-miR-581	CLIP-seq
MIRT2066912	hsa-miR-582-5p	CLIP-seq
MIRT1228515	hsa-miR-587	CLIP-seq
MIRT1228517	hsa-miR-592	CLIP-seq
MIRT1228518	hsa-miR-597	CLIP-seq
MIRT1228519	hsa-miR-599	CLIP-seq
MIRT2294556	hsa-miR-604	CLIP-seq
MIRT2294557	hsa-miR-607	CLIP-seq
MIRT2294558	hsa-miR-613	CLIP-seq
MIRT2294559	hsa-miR-617	CLIP-seq
MIRT1228520	hsa-miR-619	CLIP-seq
MIRT2294560	hsa-miR-622	CLIP-seq
MIRT1228522	hsa-miR-631	CLIP-seq
MIRT2294561	hsa-miR-634	CLIP-seq
MIRT1228523	hsa-miR-635	CLIP-seq
MIRT2066913	hsa-miR-642b	CLIP-seq
MIRT2294562	hsa-miR-649	CLIP-seq
MIRT1228526	hsa-miR-650	CLIP-seq
MIRT2294563	hsa-miR-657	CLIP-seq
MIRT1228529	hsa-miR-664	CLIP-seq
MIRT2066914	hsa-miR-665	CLIP-seq
MIRT1228530	hsa-miR-668	CLIP-seq
MIRT2294564	hsa-miR-711	CLIP-seq
MIRT2294565	hsa-miR-759	CLIP-seq
MIRT2294566	hsa-miR-761	CLIP-seq
MIRT2294567	hsa-miR-766	CLIP-seq
MIRT2294568	hsa-miR-767-3p	CLIP-seq
MIRT2294422	hsa-miR-875-3p	CLIP-seq
MIRT2294569	hsa-miR-875-5p	CLIP-seq
MIRT1228536	hsa-miR-888	CLIP-seq
MIRT2066915	hsa-miR-889	CLIP-seq
MIRT1228537	hsa-miR-934	CLIP-seq
MIRT2066917	hsa-miR-940	CLIP-seq
MIRT1228540	hsa-miR-98	CLIP-seq
MIRT2294570	hsa-miR-99a	CLIP-seq
MIRT2294571	hsa-miR-99b	CLIP-seq
MIRT1228358	hsa-miR-1279	CLIP-seq
MIRT2066821	hsa-miR-1305	CLIP-seq
MIRT2066826	hsa-miR-1827	CLIP-seq
MIRT2066833	hsa-miR-223	CLIP-seq
MIRT1228403	hsa-miR-3612	CLIP-seq
MIRT2294413	hsa-miR-421	CLIP-seq
MIRT1228442	hsa-miR-4310	CLIP-seq
MIRT1228445	hsa-miR-4328	CLIP-seq
MIRT1228447	hsa-miR-4443	CLIP-seq
MIRT2294517	hsa-miR-4637	CLIP-seq
MIRT2392449	hsa-miR-495	CLIP-seq
MIRT2066908	hsa-miR-548p	CLIP-seq
MIRT1228512	hsa-miR-578	CLIP-seq
MIRT1228526	hsa-miR-650	CLIP-seq
MIRT2066917	hsa-miR-940	CLIP-seq
MIRT2592350	hsa-miR-1184	CLIP-seq
MIRT2592351	hsa-miR-1205	CLIP-seq
MIRT2592352	hsa-miR-1273d	CLIP-seq
MIRT2592353	hsa-miR-127-5p	CLIP-seq
MIRT2066827	hsa-miR-186	CLIP-seq
MIRT2592354	hsa-miR-2054	CLIP-seq
MIRT2592355	hsa-miR-3134	CLIP-seq
MIRT2066843	hsa-miR-3158-5p	CLIP-seq
MIRT2294481	hsa-miR-338-3p	CLIP-seq
MIRT2592356	hsa-miR-339-5p	CLIP-seq
MIRT2592357	hsa-miR-3688-3p	CLIP-seq
MIRT2592358	hsa-miR-4263	CLIP-seq
MIRT2592359	hsa-miR-4289	CLIP-seq
MIRT2294515	hsa-miR-4530	CLIP-seq
MIRT2592360	hsa-miR-4534	CLIP-seq
MIRT2066879	hsa-miR-4691-5p	CLIP-seq
MIRT2066893	hsa-miR-4766-5p	CLIP-seq
MIRT1228487	hsa-miR-4799-5p	CLIP-seq
MIRT1228488	hsa-miR-486-5p	CLIP-seq
MIRT2592361	hsa-miR-512-3p	CLIP-seq
MIRT2592362	hsa-miR-548ag	CLIP-seq
MIRT2592363	hsa-miR-548ai	CLIP-seq
MIRT1228511	hsa-miR-576-5p	CLIP-seq
MIRT2592364	hsa-miR-660	CLIP-seq
MIRT1228531	hsa-miR-670	CLIP-seq
MIRT2294567	hsa-miR-766	CLIP-seq
MIRT2592352	hsa-miR-1273d	CLIP-seq
MIRT2592354	hsa-miR-2054	CLIP-seq
MIRT2592355	hsa-miR-3134	CLIP-seq
MIRT2592357	hsa-miR-3688-3p	CLIP-seq
MIRT1228434	hsa-miR-3974	CLIP-seq
MIRT2592358	hsa-miR-4263	CLIP-seq
MIRT2592359	hsa-miR-4289	CLIP-seq
MIRT1228442	hsa-miR-4310	CLIP-seq
MIRT2592360	hsa-miR-4534	CLIP-seq
MIRT1228487	hsa-miR-4799-5p	CLIP-seq
MIRT2592362	hsa-miR-548ag	CLIP-seq
MIRT2592363	hsa-miR-548ai	CLIP-seq
MIRT1228511	hsa-miR-576-5p	CLIP-seq
MIRT2592364	hsa-miR-660	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ESR1	Activation	10894148;12554765
ESR1	Unknown	10835496
FOS	Unknown	14684847
HOXA5	Activation	10875927
JUN	Repression	14684847
KLF9	Unknown	20463357
NFIL3	Unknown	1620116
RELA	Repression	8626413
SP1	Activation	10894148

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	37478846
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	17785366
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001223	Function	Transcription coactivator binding	IPI	17015480
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	17785366
GO:0001542	Process	Ovulation from ovarian follicle	IEA
GO:0002070	Process	Epithelial cell maturation	IEA
GO:0002071	Process	Glandular epithelial cell maturation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	3551956
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	IDA	9620806, 10757795
GO:0003707	Function	Nuclear steroid receptor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	TAS	10840043
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0005102	Function	Signaling receptor binding	IPI	12771131
GO:0005496	Function	Steroid binding	IEA
GO:0005515	Function	Protein binding	IPI	1517211, 12011095, 12612073, 12917342, 17347654, 20876300, 21184768, 22396492, 23995840, 26153859
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IMP	22031296
GO:0006355	Process	Regulation of DNA-templated transcription	EXP	20861224
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007165	Process	Signal transduction	TAS	1557371
GO:0007267	Process	Cell-cell signaling	TAS	1557371
GO:0008270	Function	Zinc ion binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0010628	Process	Positive regulation of gene expression	NAS	22492871
GO:0010629	Process	Negative regulation of gene expression	IEP	21695196
GO:0016020	Component	Membrane	IEA
GO:0019899	Function	Enzyme binding	IPI	12039952
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IBA
GO:0030879	Process	Mammary gland development	IEA
GO:0034056	Function	Estrogen response element binding	IBA
GO:0038001	Process	Paracrine signaling	IEA
GO:0042802	Function	Identical protein binding	IPI	17277083, 24909783
GO:0043401	Process	Steroid hormone receptor signaling pathway	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17785366
GO:0046872	Function	Metal ion binding	IEA
GO:0048286	Process	Lung alveolus development	IEA
GO:0050678	Process	Regulation of epithelial cell proliferation	IEA
GO:0050847	Process	Progesterone receptor signaling pathway	IC	22031296
GO:0050847	Process	Progesterone receptor signaling pathway	IDA	10757795
GO:0050847	Process	Progesterone receptor signaling pathway	IDA	9620806
GO:0050847	Process	Progesterone receptor signaling pathway	IEA
GO:0050847	Process	Progesterone receptor signaling pathway	IMP	10757795
GO:0051117	Function	ATPase binding	IDA	12058073
GO:0051457	Process	Maintenance of protein location in nucleus	IMP	20861224
GO:0060748	Process	Tertiary branching involved in mammary gland duct morphogenesis	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

Other IDs

• MIM: 607311
• HGNC: 8910
• e!Ensembl: ENSG00000082175

Protein

• UniProt ID: P06401
• Protein name: Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)
• Protein function: The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Depending on the isoform, progesterone receptor functions as a transcr
• PDB: 1A28, 1E3K, 1SQN, 1SR7, 1ZUC, 2C7A, 2OVH, 2OVM, 2W8Y, 3D90, 3G8O, 3HQ5, 3KBA, 3ZR7, 3ZRA, 3ZRB, 4A2J, 4APU, 4OAR, 5CC0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02161	Prog_receptor	1 → 564	Progesterone receptor	Family
  PF00105	zf-C4	565 → 634	Zinc finger, C4 type (two domains)	Domain
  PF00104	Hormone_recep	704 → 891	Ligand-binding domain of nuclear hormone receptor	Domain

• Tissue specificity: TISSUE SPECIFICITY: In reproductive tissues the expression of isoform A and isoform B varies as a consequence of developmental and hormonal status. Isoform A and isoform B are expressed in comparable levels in uterine glandular epithelium during the proli
• Sequence:

  MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLF
  PRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLA
  PSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAA
  AHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGK
  PRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTV
  MDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPD
  CAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG
  PPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPC
  KAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPP
  YLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHN
  YLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPV
  GVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQ
  LGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAP
  DLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQ
  FEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRA
  LSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK

• Sequence length: 933

Pathways

KEGG:

Oocyte meiosis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Chemical carcinogenesis - receptor activation
Breast cancer

Reactome:

Nuclear signaling by ERBB4
HSP90 chaperone cycle for steroid hormone receptors (SHR)
Nuclear Receptor transcription pathway
SUMOylation of intracellular receptors
Estrogen-dependent gene expression

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHIARI-FROMMEL SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPROLACTINEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENINGIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	29186366		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10644942, 1325950, 15309708, 15900599, 16601283, 16873885, 19706809, 19758455, 20534993, 30066930, 30087072, 7867003, 8491764, 8729985		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	15639718		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	20453000		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19706809, 19875972, 30628926		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	15639718		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	11342781, 24495253, 30022838		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	15639718		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	15639718		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	BEFREE	25357113		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15894675		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	18508999		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	LHGDN	18508999		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	18508999		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33981288	Associate	★☆☆☆☆ Found in Text Mining only
Adult Craniopharyngioma	Craniopharyngioma	BEFREE	9402587		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	18508999, 23799842, 26011570		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	22509838		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	27768897	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	10644942, 21564416		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	11604247		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	15637090		★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	17301976	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	17301976	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	12197329	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	3004547	Inhibit	★☆☆☆☆ Found in Text Mining only
Angioblastic Meningioma	Angioblastic Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Angiomatous Meningioma	Angiomatous Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	15698546, 28041593		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	29092024		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	18508999, 23799842, 26011570		★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	37864259	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29848990	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27188427		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11604247, 22542550, 23474171, 25514083		★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 2	Atelosteogenesis	Pubtator	27477822	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	25856298	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	21480233		★☆☆☆☆ Found in Text Mining only
Atypical Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	24405633		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	37673435	Stimulate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	37673435	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	18835831	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	18386458		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23098454, 28476823, 29227976		★☆☆☆☆ Found in Text Mining only
Benign Meningioma	Benign Meningioma	BEFREE	15912882		★☆☆☆☆ Found in Text Mining only
Benign Meningioma	Benign Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	27125450		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	27857885	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30737158		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	22898337, 26908328, 33342817	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11131982, 25802405, 27986121, 30614867		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	17695462, 22547541, 23224376	Associate	★☆☆☆☆ Found in Text Mining only
Breast cancer, lobular	Breast Cancer	BEFREE	24815444, 31234641		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10199781, 10211613, 10326794, 10389938, 10408841, 10516853, 10656995, 10707953, 10811106, 10819507, 10875927, 10894148, 10955825, 11042568, 11275791, 11299837, 11384868, 11501578, 11555606, 11676860, 11727956, 11862478, 11867264, 11872638, 11948015, 12010857, 12021276, 12037031, 12038703, 12125913, 12208729, 12429812, 12431808, 12529347, 12554765, 12559052, 12579263, 12602927, 12611462, 12673676, 12740157, 12759236, 12879463, 1391976, 14500352, 14522892, 15056229, 15111762, 15169914, 15183540, 15492289, 15535845, 15598772, 15604249, 15632380, 15860260, 15868434, 15945099, 15958648, 15976005, 16084894, 16103053, 16168103, 16194824, 16273221, 16314399, 16319978, 16327981, 16417653, 16446345, 16452193, 16491124, 16614108, 16753605, 16827106, 16901971, 16951137, 17006756, 17015480, 17078870, 17105164, 17211474, 17259345, 1728420, 17318377, 17356170, 17393979, 17457609, 17464097, 17522428, 17592773, 17616809, 17662154, 17687644, 17689241, 17717077, 17827444, 17875737, 17893877, 17896177, 17910759, 17919323, 17940865, 18048329, 18171422, 18197783, 18307012, 18315597, 18378698, 18386815, 18405391, 18425577, 18483177, 18534850, 18557990, 18628428, 18631401, 18657139, 18668363, 18720522, 18752049, 18819936, 18950515, 18979234, 19028704, 19117995, 19225135, 19305383, 19351835, 19372580, 19381686, 19383543, 19423537, 19462450, 19469640, 19538528, 19588487, 19632824, 19657672, 19657752, 19706513, 19744559, 19843668, 19846565, 19861523, 19875972, 1988075, 19930682, 20056651, 20073617, 20076999, 20082859, 20205715, 20208479, 20403033, 20404095, 20404251, 20436503, 20490325, 20496165, 2054780, 20550710, 20569503, 20635137, 20683691, 20690804, 20712647, 20713855, 20724461, 20798217, 20815046, 20853316, 20863372, 20876300, 20929399, 20980435, 21105050, 21111561, 21168492, 21247402, 21315418, 21326033, 21338212, 21358301, 21435948, 21459801, 21524465, 21531767, 21604016, 21642474, 21668473, 21795498, 21803008, 21852249, 21868547, 22011446, 22020934, 22026417, 22035181, 22053997, 22112941, 22270937, 22279545, 22301704, 22320983, 22330642, 22331459, 22348324, 22543272, 22584640, 22644676, 22699783, 22751120, 22875649, 22903472, 22918168, 22929433, 22949935, 22956396, 23001908, 23029355, 23035882, 23115015, 23124476, 23136140, 23184080, 23184698, 23222299, 23251644, 23329648, 23336272, 23339407, 23341997, 23380370, 23485561, 23592700, 2364377, 23669457, 23696593, 2373707, 23764995, 23817433, 23832257, 23881388, 23935996, 23971947, 23977306, 24036662, 24099425, 24099914, 24147030, 24176089, 24185965, 24188694, 24300977, 24301790, 24345432, 24356943, 24414391, 24430361, 24469035, 24548865, 24606123, 24635704, 24670641, 24670917, 24777335, 24781337, 24848085, 24897521, 25176561, 25238878, 25283550, 25329395, 25337220, 25421376, 25453096, 25479686, 2550815, 25537643, 25592378, 25600243, 25613069, 25629224, 25689428, 2576982, 25802405, 25831047, 25847929, 25880075, 25917868, 25928379, 25981901, 26153859, 26165253, 26251519, 26277479, 26280679, 26331797, 26356672, 26403396, 26455641, 26458489, 26474308, 26552431, 26625804, 26657878, 26694831, 26831511, 26834106, 26916849, 26950360, 27029805, 27052658, 27072207, 27109339, 27181204, 27184049, 27215412, 27224909, 27246982, 27315045, 27340922, 27357606, 27386569, 27466487, 27467053, 27477822, 27479811, 27499099, 27542969, 27604554, 27620353, 27634883, 27748277, 27775705, 27784743, 27793424, 27796944, 27807724, 27813227, 27816721, 27955963, 28060723, 28064072, 28099174, 28114999, 28147315, 28173783, 28177907, 28187031, 28243121, 28251385, 28280092, 28285967, 28337559, 28362679, 28376177, 28404930, 28412963, 28416776, 28423605, 28454423, 28460643, 28467815, 28470951, 28472544, 28476053, 28489882, 28490348, 28534357, 28588725, 28595043, 28595965, 28607590, 28610679, 28613390, 28632174, 28653288, 28684637, 28689363, 28690652, 28714765, 28724391, 28724435, 28734944, 28766230, 28789451, 28789455, 28825136, 28830573, 28875243, 28876975, 28899737, 28929029, 28929346, 28954821, 28964592, 28978063, 29029640, 29031688, 29051317, 29084518, 29116004, 29119620, 29126102, 29144542, 29146052, 29162724, 29179434, 29212872, 29260362, 29273958, 29282680, 29302853, 29317254, 29345201, 29361816, 29370776, 29378534, 29403307, 29409530, 29416660, 29434058, 29435103, 29444670, 29465777, 29467480, 29477637, 29502324, 29512727, 29524829, 29550639, 29573665, 29578175, 29588372, 29599329, 29625565, 29633513, 29673111, 29716928, 29718790, 29758480, 29772460, 29843215, 29849791, 29858579, 29877575, 29885789, 29931120, 29978332, 29991638, 30007834, 30013390, 30030339, 30054430, 30066060, 30066930, 30087072, 30097312, 30099541, 30102524, 30131927, 30138940, 30160021, 30171067, 30179118, 30197799, 30203004, 30224719, 30228212, 30252931, 30267987, 30290658, 30290832, 30293712, 30321870, 30324661, 30337371, 30338035, 30338425, 30346453, 30358192, 30410061, 30415281, 30416383, 30458011, 30511789, 30546460, 30597041, 30655757, 30658681, 30668861, 30680688, 30694768, 30791936, 30796353, 30816620, 30821186, 30823890, 30824542, 30841783, 30847396, 30851122, 30854047, 30867002, 30867801, 30915533, 30921201, 30936295, 30962496, 30968114, 31003528, 31007067, 31011629, 31014197, 31020993, 31028134, 31087799, 31088482, 31092464, 31095790, 31110518, 31112577, 31120565, 31146185, 31158261, 31166208, 31190183, 31190337, 31192530, 31197914, 31258749, 31263129, 31276668, 31289516, 31330414, 31358030, 31366535, 31426542, 31430979, 31502168, 31562879, 31572543, 31588183, 31603096, 31640622, 31644578, 31665670, 31677938, 31732674, 31763970, 31786854, 3342760, 3398853, 3551956, 3873417, 7499360, 7612493, 7812959, 7821706, 7922981, 7927940, 8049459, 8150542, 8156519, 8530508, 8603052, 8625078, 8722747, 8919544, 8956795, 9467558, 9510472, 9615760, 9652611, 9699871, 9802620, 9815968		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19436038, 21501481		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	28470951	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10188907, 10408841, 10623650, 10737385, 10751396, 10815760, 10823126, 10883885, 10970687, 11042612, 11056336, 11140706, 11509655, 11556039, 11717311, 11747343, 11862478, 12021276, 12037031, 12548595, 12556966, 12559052, 12699057, 12759236, 1378057, 1419611, 14582137, 14669271, 14979918, 15169914, 15178346, 15255541, 15255542, 15329896, 15470903, 15535845, 15619641, 15628988, 15728178, 15917412, 16080475, 16084894, 16085689, 16168103, 1616860, 16703595, 16711511, 16760268, 16799708, 16827106, 16980602, 17015480, 17054791, 17074804, 17078870, 17121430, 17146782, 17167183, 17211474, 17347654, 17352236, 17430582, 17436274, 17522428, 17591366, 17591932, 17611401, 17662154, 17712311, 18202149, 18286776, 18317449, 18378698, 18425577, 18483177, 18534850, 18596862, 18628428, 18644990, 18645713, 18668364, 18726992, 18828867, 18947395, 19028704, 19117995, 19136201, 19147544, 19190139, 19208263, 19225135, 19256737, 19259095, 19299443, 19419938, 19423537, 19432961, 19462450, 19483093, 19531212, 19551847, 19567422, 19574486, 19596702, 19620495, 19632824, 19651608, 19706513, 19762712, 19800460, 19819143, 19828073, 19843668, 19846565, 19858088, 19861523, 20104967, 20104975, 20123965, 20144226, 20205715, 20228224, 20233903, 20332278, 2049973, 20540763, 20551954, 20569503, 20705559, 20863372, 20886231, 20920219, 20980435, 21092082, 21092257, 21119029, 21152100, 21184265, 21191117, 21203526, 21231986, 21247819, 21263059, 21291899, 2139575, 21459801, 21472707, 21479875, 21502402, 21619605, 21627355, 21631949, 21729671, 21761355, 21762477, 21791674, 21795498, 21816898, 21826535, 21861179, 21865043, 21914172, 22020934, 22022496, 22026417, 22037553, 22053997, 22128125, 22144499, 22207430, 22238615, 22245973, 22272226, 22293249, 22298467, 22330642, 22331459, 22348324, 22393992, 22395643, 22439847, 22452927, 22461340, 22524806, 22543272, 22545144, 22547541, 22577295, 22584640, 22618884, 22621334, 22647834, 22658320, 22697792, 22738860, 22751729, 22773826, 22797202, 22799290, 22799305, 22835918, 22898337, 22903686, 22918168, 22922095, 22929433, 22949935, 22956396, 22961208, 23001908, 23022996, 23029355, 23079975, 23090068, 23098454, 23157797, 23159947, 23166647, 23177737, 23184698, 23233704, 23244108, 23244146, 23251644, 23271326, 2328727, 23299531, 23322423, 23339407, 23368093, 23380370, 23404160, 23485561, 23558572, 23568563, 23579222, 23613389, 23616122, 23699411, 23701942, 23704202, 23723333, 23725118, 2373707, 23764995, 23776684, 23812730, 23818347, 23819905, 23828499, 23886210, 23921636, 23922822, 23947965, 23950631, 23957561, 23965901, 23971947, 23977244, 23988382, 24008056, 24008095, 24065467, 24068038, 24070170, 24086515, 24103091, 24114857, 24119434, 24146960, 24166281, 24177593, 24207091, 24228128, 24300977, 24337596, 24344008, 24398991, 24409301, 24414130, 24414391, 24427354, 24430361, 24469035, 24481062, 24549642, 24591826, 24672785, 24731990, 24762482, 24777335, 24785096, 24815444, 24864130, 24865188, 24870798, 24897521, 24951027, 24999743, 25005788, 25009196, 25047098, 25068292, 25070479, 25080362, 25081661, 25082024, 25084155, 25124582, 25170613, 25174527, 25220500, 25261646, 25269750, 25329395, 25337220, 25338319, 25338681, 25339035, 25352523, 25352526, 25360542, 25411418, 25412710, 25421113, 25421376, 25423363, 25424702, 25560175, 25570853, 25573962, 25592378, 25613123, 25701109, 25755795, 25802405, 25831047, 25850931, 25880075, 25919761, 25929808, 25938238, 25961581, 25971350, 25986046, 25992689, 25994573, 26041687, 26053183, 26091472, 26112049, 26147891, 26161666, 26163622, 26177331, 26260940, 26266392, 26280679, 26302375, 26304457, 26318038, 26319120, 26323259, 26384297, 26392082, 26437901, 26448179, 26458489, 26458823, 26474308, 26496879, 26498662, 26514283, 26546331, 26577046, 26657878, 26670335, 26711786, 26739972, 26797453, 26820652, 26823864, 26829108, 26916849, 26964534, 26970778, 27022068, 27022606, 27029768, 27050280, 27052658, 27061526, 2708354, 27109339, 27129866, 2713239, 27144536, 27191888, 27215412, 27221883, 27224909, 27314854, 27315045, 27386569, 27389414, 27390128, 27456970, 27467053, 27477822, 27509976, 27542969, 27556158, 27569075, 27573671, 27619909, 27708239, 27729430, 27760178, 27760283, 27829423, 27836010, 27837613, 27852068, 28009468, 28030809, 28039703, 28060723, 28086982, 28108260, 28127872, 28173783, 28208155, 28213701, 28241804, 28244460, 28345661, 28353608, 28356061, 28365833, 28376177, 28404930, 28404972, 28412963, 28467815, 28472544, 28490348, 28532429, 28534357, 28541721, 28652562, 28684637, 28692043, 28692125, 28697743, 28714765, 28766230, 28851309, 28855612, 28876975, 28891017, 28929346, 29029640, 29126102, 29243084, 29251737, 29260362, 29278880, 29286222, 29286917, 29302853, 29361816, 29409530, 29544444, 29587674, 29661221, 29673111, 29748526, 29843215, 29858579, 29958276, 3004547, 30066060, 30097312, 30185547, 30192170, 30327501, 30337371, 30342538, 30403669, 30407916, 30410061, 30412123, 30443844, 30509049, 30597041, 30613307, 30691046, 30722113, 30756285, 30841783, 30852142, 30866472, 30902883, 30936295, 30951390, 31028134, 31087799, 31088428, 31120565, 31158261, 31168174, 31263129, 31308460, 31343899, 31358030, 31359505, 31402456, 31410192, 31450891, 31533668, 31533777, 31598691, 31603099, 31640622, 31733575, 31856290, 31856858, 31883437, 31917424, 32070401, 32091585, 32183159, 32210727, 32235849, 32285914, 32291973, 32298374, 32391191, 32429997, 32445323, 32489268, 32493230, 32566676, 32569215, 32592349, 32620918, 32622530, 32632815, 32681437, 32682413, 32710281, 32808350, 32917222, 32985495, 33011748, 33046470, 33101542, 33108409, 33112117, 33112958, 33138797, 33228656, 33335078, 33342777, 33413654, 33439420, 33461170, 33495599, 33541297, 33545761, 33635448, 33639682, 33667252, 33806648, 33854672, 33864589, 33903732, 33923732, 33927073, 33950817, 33975551, 34022815, 34024810, 34050358, 34057115, 34102222, 34161883, 34172056, 34244052, 34257555, 34257557, 34268929, 34319027, 34371382, 34392135, 34408238, 34464510, 34544424, 34555047, 34556523, 34707101, 34813298, 34898327, 34922607, 34983606, 34990474, 35006257, 35017776, 35074178, 35084436, 35105882, 35119458, 35135604, 35305101, 35321515, 35466619, 35478111, 35501747, 35558081, 35617163, 35627287, 35634843, 35701800, 35711896, 35726195, 3580270, 35873667, 35933885, 35946088, 35980268, 36012443, 36129548, 36197762, 36269797, 36508355, 36510982, 36527133, 36531979, 36578092, 36592233, 36653923, 36705562, 36721218, 36769215, 36833223, 36862902, 36946266, 36988307, 37041481, 37180578, 37244387, 37299011, 37355881, 37378936, 37395734, 37481512, 37524746, 37653831, 37682272, 37705026, 37746948, 37759508, 37963835, 38021219, 38048919, 38049758, 38060195, 38090235, 38153734, 38166892, 38503615, 38631690, 39187318, 39193850, 39275851, 39614188, 39706710, 39780930, 39985907, 40016720, 40101318, 40283001, 40377604, 40482448, 40527014, 40597935, 40604083, 40721928, 6683273, 7515559, 7799933, 7880720, 7972059, 8328824, 8394731, 8519655, 8805931, 9166949, 9510472, 9535862, 9813040	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	19459041, 28470951, 29128898, 39242688	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	19609101, 22901142, 25292074, 27340922, 27462784, 30373175, 34636027, 35128817, 35580079, 35992051, 38167641	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	19442295, 24322022, 29092024, 29396493, 30577860, 33964913, 40302091	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19382201, 19820388, 21343929, 23029355, 23199240, 23485561, 24897521, 26498662, 34898327	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25229191	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10403901, 10514407, 11299837, 12602927, 15183540, 15641021, 16211220, 16319259, 16601291, 20208479, 21358618, 22173289, 22882517, 22903472, 23908451, 2529025, 25357113, 26092192, 26266392, 28285967, 29137369, 29324536, 29523126, 29956066, 30060844, 30125583, 7496840, 7738169, 7919121, 8491764, 8956795, 9815973		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	15637090		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	28069049, 29187928	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	20614336	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	11994759, 16033090, 16512896, 22524806, 23535842, 24862985, 24917206, 25339035, 26319120, 27928699, 28365833, 28765906, 29858579, 30633152, 35051228	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	14567723, 22424533, 23873108, 26319120, 27517320, 34001017	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	30905927	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	14595509, 23845225, 26036714	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	16999816, 18219286, 20593959, 21709441, 22295150, 23818363, 26299454, 26830028, 28264438, 28832070, 28990139, 29851704, 30479097, 30614867, 31495455, 37352704, 37773079, 38358190, 40011117	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	26431491, 35992051	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17589901, 29563759	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	40362654	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	15361203		★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	12037031, 12865917, 16033090, 16528377, 17453296, 18043578, 21139586, 23756858, 23778411, 24978026, 26496879, 26769139, 28178722, 29858579, 30383678, 33727261, 33795819, 34001017	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	21126378, 27837612, 28365833, 28412963, 35051228, 37500962, 40681988, 8328824	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	25682191	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	38631690	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	14567723	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30737158		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19595472, 21062926, 21179495, 24398390		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	20625818, 30558615, 30577860, 9646036		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	11076658, 19560192, 29187928, 34071938, 38012622	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21614520	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	12377812, 34061869	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22977660	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32279409	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	16014119	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	15599594, 28472813	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	15639718		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	11342781, 19898223, 24495253, 29250656, 29851704, 30022838, 30614867		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	15639718		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11323389, 11668524, 12038703, 14769635, 15579801, 15632380, 15718480, 16360811, 18219286, 18319313, 18384825, 20869977, 21056906, 21695196, 24057181, 24114859, 24197980, 25228088, 28264438, 28415663, 29137401, 29208958, 29885789, 30325501, 30448218, 31495455, 31616183, 7880723, 9816065		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	15637090		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	19200930	Associate	★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	20605134	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	16417654	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	12037031, 18473330, 20920981, 25007177, 28108967, 29568948, 31281731, 31632852		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	LHGDN	17951080		★☆☆☆☆ Found in Text Mining only
Cerebral Convexity Meningioma	Cerebral Convexity Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	26531187		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15361203, 28472813, 30957588, 31732107		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	1651807, 31732107		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15361203, 28472813, 30957588, 31732107		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	14608378		★☆☆☆☆ Found in Text Mining only
Chloasma	Melasma	BEFREE	25439299		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholecystolithiasis	Pubtator	23577061	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	19742314	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	11131982		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	18042733		★☆☆☆☆ Found in Text Mining only
Clear Cell Meningioma	Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	31634489		★☆☆☆☆ Found in Text Mining only
Coffin-Siris syndrome	Coffin-Siris Syndrome	BEFREE	28888581		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	36741232	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20880178, 21490239, 21627810, 27376509, 29885789, 31590647		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	19093516		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27376509, 31590647, 32334485, 36741232, 37206439, 38144182	Associate	★☆☆☆☆ Found in Text Mining only
Comedone	Comedone	BEFREE	23548208, 27704370, 30322671		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30015972		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	9402587		★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic Neutropenia	BEFREE	28560596		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	29705270		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30252931		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	29878374		★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus	Diabetes Insipidus	BEFREE	23412097		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25854171	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29417738	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29417738, 30679303, 31395589		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	23873108, 25313758, 29744672, 29904427		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	11994759, 20813035, 25313758, 29744672, 29904427		★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	21564416, 23122929, 31395281		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	16827106, 35732909	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	40597935	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	15555905, 15987820, 16024066, 19758455, 28454369, 30655341, 7520702, 8610642, 8650238, 9009235		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10101596, 10644942, 11034074, 11196205, 11282273, 11303185, 11603221, 12051868, 12170086, 12218173, 12770752, 12873984, 14519645, 14601091, 14719079, 14751175, 14974442, 15010819, 15099952, 15637718, 15657363, 16024066, 16999816, 17240435, 17291258, 1733196, 17556066, 18280760, 18292933, 19382201, 20077528, 20547493, 20564127, 21148628, 21168492, 21363919, 22210468, 22633539, 22911547, 22911820, 23306391, 23888956, 24405633, 24531693, 24756855, 25037596, 25229191, 25304370, 26428028, 26842712, 26859414, 26881523, 26996671, 27163153, 27262401, 27288544, 27888807, 28052940, 28112250, 28476021, 28516379, 28540420, 28582344, 29081408, 29250656, 29406446, 29453736, 29636868, 30443761, 30616900, 31037767, 31072420, 31220580, 31395281, 31781484, 9581825		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	23200943		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Diseases	Endometrial Diseases	BEFREE	31764773		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	11443221, 20955098, 25809780, 29250656, 30548528		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	22102068, 25495249, 36498921	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	29250656	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	12218173, 12402980, 12517594, 14519645, 15866121, 16999816, 18096667, 18386458		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	12218173, 14689303, 15178346, 15589577, 16648864, 16822874, 16980945, 16999816, 17291258, 17695457, 18096667, 19382201, 19758455, 19820388, 1985102, 20547493, 20593959, 21148628, 21343929, 21734474, 22249577, 22295114, 22633539, 22683940, 23055021, 23530112, 23706170, 23719407, 23888956, 23932335, 24030769, 24684970, 25201050, 25229191, 25308734, 26036714, 26218748, 26299454, 26434913, 26825822, 26859414, 26868332, 27288544, 27384477, 28052940, 28112250, 28476021, 28498246, 28516379, 28764605, 29081408, 2921355, 29324536, 30277666, 30521558, 31268882, 31909459, 32127819, 32210157, 32413043, 32583986, 32639950, 32733932, 34337010, 34953233, 35018885, 35226658, 35326450, 35717540, 35821038, 36348508, 36498921, 36575819, 37144734, 37716459, 37723477, 37725629, 38358190, 39515079, 40011117, 40138919, 40243611, 9389825, 9635673	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	23200943		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	28052940		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35796805	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	18580489, 22918161, 28114189, 29406332		★☆☆☆☆ Found in Text Mining only
Endometrioid carcinoma ovary	Ovarian endometrioid carcinoma	BEFREE	28264438		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642, 21232532		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	24064688, 27452080		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	10605405, 11821088, 16009159, 17484509, 17522428, 18281038, 19454514, 19497994, 20400074, 20719308, 21751163, 22259059, 22520060, 22977660, 24064688, 25217304, 28614857, 29383962, 29629944, 32733932, 33743689, 33817715, 34144151, 34794738, 35387670, 36672827, 36752987, 36860677, 37867352	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	10946900, 11821088, 15272913, 15598772, 15831511, 16009159, 16126772, 16406281, 16418212, 16920727, 17484509, 17522428, 17965625, 18280760, 18281038, 19013437, 19389829, 19497994, 20097334, 20104427, 20108182, 20400074, 20586553, 20719308, 21243274, 21751163, 21972997, 22259059, 23183084, 24064688, 24481237, 24943061, 24955763, 25155819, 25533385, 25767055, 26036904, 27593876, 27619769, 27914766, 28742263, 28891417, 29383962, 29615065, 29762665, 29998468, 30034593, 30203794, 30357380, 30638056, 30782101, 31814016, 7805924		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	LHGDN	16920727, 17413977, 17484509, 18048499, 18249378, 18281038		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	CTD_human_DG	20864642, 21232532		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	21614520, 27593876	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelial ovarian cancer	Ovarian cancer	BEFREE	11323389, 21695196, 24114859, 29137401, 29208958, 9816065		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	11342781		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	12602927		★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	21286874	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	12065682, 12413982, 15807882, 17785366, 19176543, 19240151, 19499404, 20124487, 20601542, 21672608, 22350293, 24324590, 24423317, 28203428, 28637297, 29630404, 29729689, 29741640, 30390345, 30567472, 31504629, 7775635, 8187322, 8333481, 9253340		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	15572421, 17224149, 17646097, 17785366, 17992477		★☆☆☆☆ Found in Text Mining only
Fibrous Meningioma	Fibrous Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	22808109		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	22808109	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	39234749	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	35429182	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	29878374		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11604247, 27663075, 27717886, 27986121, 29453736		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26933808, 33841333, 33916643	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30143669	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27663075, 27717886, 27986121, 29453736		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30143669, 38062999	Associate	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	35876683	Inhibit	★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	LHGDN	17885486		★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	30661765		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	23907943	Associate	★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	BEFREE	29772574		★☆☆☆☆ Found in Text Mining only
Hemangioblastic Meningioma	Hemangioblastic Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Hemangiopericytic Meningioma	Hemangiopericytic Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	15215164	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	18204202, 24148581	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	19305383, 19436038, 22713661, 24337596, 24951027, 25421376, 26053183, 27029768	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	17589901	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	17919323, 22584640, 23970364, 25591549, 30614867, 32393308, 37390283, 40482448	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	25076292	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	28560596		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	18174609	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	15912882	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	30479097	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	26036714	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	30285886	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	25854171	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	11676860	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37773134	Associate	★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	18835831	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	11212228, 16951220, 19198217, 21092257, 2181374, 30275857, 30338425, 30933323		★☆☆☆☆ Found in Text Mining only
Intracranial Meningioma	Intracranial Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Intraorbital Meningioma	Intraorbital Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Intraventricular Meningioma	Intraventricular Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	1347986, 17985332, 23873108, 25357113, 25845386, 27928699, 27993580, 28856077, 29889754, 30110018, 30170496, 31119054, 31281731		★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	29331723		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	29258902, 9891238		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	12413982, 17224149, 17522428, 19240151, 22217299, 22272226, 22329840, 25607395, 26006736, 28600036, 28637297, 29303226, 29741640, 30538295, 31804368, 31843092, 33186388, 33865567, 34388365, 35974345	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	27100507	Stimulate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	15066464, 19633649, 24222211, 25418451, 25991737, 26261614, 30829727, 33788262, 38508521	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	22217299, 23334251, 25607395, 29258902	Inhibit	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	29729689, 9891238		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	BEFREE	31452763		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma, Epithelioid	Leiomyosarcoma	BEFREE	30829727, 31846533		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15178346, 18523155	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18523155	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	8695861	Associate	★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	29258902, 9891238		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	28882474		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	22584640	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29563759		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	17589901	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	35017776	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11035577, 21062926, 35235599, 38021219	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	15890247, 22644676		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20642860, 23404160, 23932335, 24864130, 25010932, 25422206, 26191291, 30722113, 32592349, 33858677, 34057115, 38358190, 40283001	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27756653, 30479097	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	19560192	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Meningioma	Malignant Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	29048219		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10199781, 10211613, 10389938, 10408841, 10516853, 10707953, 10811106, 10819507, 10875927, 10894148, 10955825, 11299837, 11384868, 11501578, 11555606, 11676860, 11727956, 11766082, 11862478, 11867264, 11872638, 11948015, 12010857, 12021276, 12037031, 12038703, 12125913, 12208729, 12431808, 12434414, 12529347, 12554765, 12559052, 12579263, 12602927, 12673676, 12740157, 12759236, 12902980, 1391976, 14500352, 14522892, 14717755, 15041725, 15111762, 15169914, 15492289, 15535845, 15598772, 15604249, 15623590, 15632380, 15860260, 15868434, 15891269, 15945099, 15958648, 15976005, 16084894, 16103053, 16194824, 16273221, 16314399, 16319978, 16327981, 16397211, 16417653, 16446345, 16452193, 16457150, 16491124, 16614108, 16650963, 16753605, 16827106, 16901971, 16951137, 17015480, 17105164, 17211474, 17259345, 1728420, 17318377, 17356170, 17393979, 17457609, 17522428, 17592773, 17616809, 17687644, 17689241, 17717077, 17827444, 17855697, 17875737, 17893877, 17896177, 17910759, 17919323, 17940865, 18048329, 18171422, 18197783, 18307012, 18315597, 18378698, 18386815, 18405391, 18425577, 18483177, 18534850, 18557990, 18628428, 18631401, 18657139, 18668363, 18720522, 18819936, 18950515, 18979234, 19028704, 19117995, 19225135, 19351835, 19372580, 19381686, 19383543, 19423537, 19462450, 19469640, 19538528, 19588487, 19609101, 19632824, 19657672, 19657752, 19706513, 19744559, 19843668, 19846565, 19861523, 19875972, 1988075, 19930682, 20056651, 20073617, 20076999, 20082859, 20149218, 20205715, 20215533, 20403033, 20404095, 20404251, 20436503, 20437200, 20490325, 20496165, 2054780, 20550710, 20569503, 20635137, 20683691, 20690804, 20712647, 20713855, 20724461, 20798217, 20853316, 20863372, 20876300, 20929399, 20980435, 21105050, 21111561, 21168492, 21315418, 21326033, 21338212, 21358301, 21369717, 21435948, 21459801, 21524465, 21531767, 21604016, 21642474, 21668473, 21795498, 2181374, 21852249, 21868547, 22020934, 22026417, 22035181, 22053997, 22112941, 22263793, 22267707, 22270937, 22279545, 22301704, 22320983, 22330642, 22331459, 22348324, 22476979, 22505232, 22543272, 22584640, 22644676, 22699783, 22751120, 22875649, 22918168, 22929433, 22956396, 23001908, 23029355, 23035882, 23115015, 23124476, 23136140, 23184080, 23184698, 23222299, 23233704, 23251644, 23329648, 23336272, 23339407, 23341997, 23380370, 23453899, 23485561, 23506684, 23592700, 2364377, 23669457, 23696593, 2373707, 23764995, 23799842, 23817433, 23832257, 23881388, 23935996, 23939688, 23971947, 23977306, 23979844, 23996077, 24036662, 24099425, 24099914, 24147030, 24176089, 24185965, 24188694, 24298072, 24300977, 24301790, 24337596, 24345432, 24356943, 24414391, 24430361, 24469035, 24481452, 24548865, 24606123, 24635704, 24670641, 24670917, 24777335, 24815444, 24848085, 24897521, 25070479, 25158022, 25176561, 25238878, 25241899, 25283550, 25329395, 25337220, 25421376, 25424702, 25453096, 25479686, 2550815, 25527230, 25537643, 25592378, 25600243, 25611337, 25613069, 25629224, 25689428, 25802405, 25831047, 25847929, 25880075, 25917868, 25928379, 25981901, 26065870, 26147891, 26153859, 26165253, 26277479, 26280679, 26356672, 26403396, 26455641, 26458489, 26474308, 26552431, 26610382, 26625804, 26657878, 26694831, 26831511, 26834106, 26916849, 26950360, 27017236, 27029805, 27052658, 27072207, 27109339, 27181204, 27184049, 27215412, 27224909, 27246982, 27315045, 27340922, 27357606, 27386569, 27466487, 27467053, 27477822, 27499099, 27542969, 27604554, 27612503, 27620353, 27634883, 27748277, 27775705, 27784743, 27793424, 27796944, 27807724, 27813227, 27816721, 27885264, 27955963, 28060723, 28064072, 28114999, 28147315, 28173783, 28177907, 28243121, 28251385, 28264697, 28280092, 28285967, 28337559, 28341031, 28362679, 28376177, 28404930, 28412963, 28416776, 28423605, 28423644, 28454423, 28460643, 28467815, 28470951, 28472544, 28489882, 28490348, 28534357, 28588725, 28589367, 28595043, 28595965, 28607590, 28610679, 28613390, 28632174, 28653288, 28684637, 28689363, 28690652, 28692125, 28714765, 28724391, 28724435, 28729413, 28734944, 28756019, 28766230, 28789451, 28789455, 28830573, 28876975, 28885360, 28899737, 28903441, 28929029, 28929346, 28954821, 28964592, 28978063, 29031688, 29051317, 29084518, 29116004, 29119620, 29126102, 29144542, 29146052, 2915900, 29162724, 29179434, 29212872, 29260362, 29273958, 29282680, 29302853, 29317254, 29356917, 29361816, 29370776, 29378534, 29403307, 29409530, 29416660, 29434058, 29435103, 29444670, 29465777, 29477637, 29502324, 29512727, 29524829, 29550639, 29573665, 29578175, 29588372, 29599329, 29625565, 29633513, 29673111, 29716928, 29718790, 29758480, 29772460, 29843215, 29849791, 29858579, 29877575, 29885789, 29931120, 29991638, 30007834, 30013390, 30030339, 30066930, 30087072, 30095467, 30097312, 30099541, 30100993, 30102524, 30138940, 30160021, 30171067, 30179118, 30197799, 30203004, 30228212, 30252931, 30267987, 30290658, 30290832, 30293712, 30321870, 30324661, 30337371, 30338035, 30338425, 30346453, 30358192, 30373175, 30410061, 30415281, 30458011, 30511789, 30546460, 30597041, 30655757, 30658681, 30668861, 30680688, 30691046, 30694768, 30796353, 30816620, 30821186, 30823890, 30824542, 30841783, 30847396, 30851122, 30854047, 30858726, 30867002, 30867801, 30915533, 30921201, 30936295, 30962496, 30968114, 31003528, 31007067, 31011629, 31014197, 31020993, 31028134, 31087799, 31088482, 31092464, 31095790, 31110518, 31112577, 31114028, 31120565, 31146185, 31166208, 31190183, 31190337, 31192530, 31197914, 31219612, 31258749, 31263129, 31276668, 31289516, 31330414, 31358030, 31366535, 31426542, 31430979, 31502168, 31547956, 31562879, 31572543, 31588183, 31603096, 31640622, 31644578, 31649747, 31665670, 31677938, 31732674, 31763970, 31786854, 3342760, 3398853, 3551956, 3873417, 7499360, 7812959, 7821706, 7922981, 7927940, 8049459, 8150542, 8156519, 8219249, 8530508, 8603052, 8722747, 8919544, 9155518, 9467558, 9510472, 9570150, 9570382, 9615760, 9652611, 9699871, 9815968, 9816234, 9823305		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19436038, 21501481		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	10644942, 11034074, 11303185, 11603221, 12218173, 12873984, 14519645, 14719079, 14974442, 15637718, 15657363, 16024066, 17291258, 17556066, 18280760, 18292933, 19382201, 20547493, 21148628, 21168492, 21363919, 22210468, 22633539, 22911547, 22911820, 23306391, 23888956, 25037596, 25229191, 25304370, 26428028, 26859414, 26881523, 26996671, 27163153, 27262401, 27288544, 27888807, 28052940, 28112250, 28476021, 28540420, 29406446, 29636868, 30443761, 30616900, 31037767, 31072420, 31220580, 31395281, 31781484, 9581825		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	22808109		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19595472, 21062926, 21179495, 21524465, 24398390		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11323389, 11668524, 12038703, 14769635, 15579801, 15598772, 15632380, 15718480, 16360811, 18219286, 18319313, 18384825, 20869977, 22092403, 24057181, 24197980, 25228088, 28264438, 28415663, 29137401, 29885789, 30325501, 31495455, 31616183, 7604206, 7880723, 9816065		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	9278646		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11280747, 11536308, 12770752, 15330195, 19147544, 25723513, 27125450, 30054508, 31783154		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	20419820		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23110082		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31644578		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30737158		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11501578, 12051868, 12185331, 12208729, 12448002, 15492289, 16214913, 17457609, 17915203, 18197009, 18384825, 19189301, 19744559, 19969469, 20179196, 21435948, 21552212, 21766210, 22121098, 22350867, 22644676, 23349706, 23723333, 23888962, 24146960, 24670641, 24785096, 25230850, 25277734, 25591549, 25613069, 2578003, 25979597, 26340863, 26458489, 26464711, 26524723, 27163153, 27859250, 27888807, 28100469, 28152150, 28176013, 28253390, 28412963, 28498246, 28586788, 28729413, 29137401, 29356917, 29406332, 29471794, 29718790, 29848684, 29885789, 29889754, 29986702, 29998468, 30053090, 30120157, 30196538, 30254198, 30254488, 30278574, 30337371, 30515157, 30541035, 30655341, 30658681, 30823890, 30869771, 31028134, 31100306, 31257479, 31348739, 31452808, 31502168, 31547832, 31787654, 7604206, 7754837, 8491764, 9527274, 9893652, 9893667		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15361203, 28472813, 30957588, 31732107		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	30099033		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19436038, 21501481		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10199781, 10211613, 10323218, 10408841, 10699900, 11042568, 11384768, 11862478, 12125913, 12825849, 15300801, 15305375, 15470903, 15860260, 15860262, 15890247, 16168121, 16375577, 1679459, 18425577, 18828867, 18979234, 19276248, 19483093, 19733895, 2018347, 20550710, 20661826, 20876300, 21980430, 22018777, 22231446, 22350867, 22559974, 22593082, 22751119, 22918168, 22956396, 23222299, 23336272, 23723333, 23912957, 24345432, 25479686, 25687182, 25802405, 25971350, 26277479, 26356672, 26941094, 27542969, 27613186, 27666130, 27729430, 27905104, 27931045, 28412963, 28457730, 28684637, 28692125, 28766230, 28975433, 30327501, 30410061, 30607631, 30695671, 30816620, 30826970, 31426542, 31428575, 31562691, 7913659, 8603052, 8722747, 9389930, 9449245, 9467558, 9615729, 9816234, 9833771		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12021276, 12554765, 12673676, 12759236, 14617569, 15102680, 15282324, 15632380, 15728178, 16168103, 16646051, 16647340, 16799708, 17522428, 17592773, 17599361, 17950525, 18184269, 18391223, 18483177, 18557990, 18645713, 18665217, 18798271, 18819936		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19436038, 21501481		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19436038, 21501481		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18481002		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28026870	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28524047		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	28353608	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	10704905, 11079777, 18980792, 19747051, 2213164, 24100643, 25237942, 29105524, 29453736, 30031954, 30112770, 30503291, 30687635, 30779850, 30868355, 31024808, 31208995, 31637512, 31679342, 7754837, 7906070, 8433149, 8443810, 8587697, 9311583		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	Pubtator	15452155, 17110681, 18172325, 21137648, 22234191, 22797202, 27543769, 33342817, 36579995, 8347484	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	LHGDN	18980792		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningiomas, Multiple	Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Meningothelial meningioma	Meningothelial Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30252931		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	CTD_human_DG	15639718		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	BEFREE	29048219		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28531113		★☆☆☆☆ Found in Text Mining only
Microcystic meningioma	Microcystic Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Microcystic stromal tumor	Microcystic Stromal Tumor	BEFREE	30325056		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	17609999, 19175383, 19673915, 23674830, 25494303		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	25494303	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	26456840	Inhibit	★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine	Pubtator	25494303	Associate	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	29202468		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	16500320, 34144151	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	11342781, 2649227, 29137401		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	30380176		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34448362, 9949172	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	25973881	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	11182013	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10389938, 10408841, 10485452, 10545804, 10619912, 10623664, 10639513, 10718210, 10819507, 10850416, 10913678, 10934144, 11042568, 11079777, 11104567, 11107050, 11115354, 11221879, 11275791, 11280747, 11299837, 11323389, 11410327, 11448907, 11536308, 11555606, 11603221, 11766082, 11821247, 11927006, 12037682, 12038703, 12051868, 12114407, 12361724, 12429812, 12438245, 12529347, 12644824, 12680147, 12680217, 12699057, 12751374, 1325950, 14598884, 14695203, 15135479, 15183540, 15300801, 15318931, 15364883, 15459782, 15492288, 15501975, 15571956, 15604991, 15623590, 15668953, 15868434, 15970648, 15982396, 16103451, 16168103, 16211220, 16297090, 16319978, 16322213, 16357129, 16417653, 16507410, 16530420, 16568452, 16645950, 16721725, 1672666, 16761620, 16762045, 16867861, 16941013, 17078870, 17085653, 17143524, 1722871, 1728611, 17318377, 17352236, 17457609, 17507346, 17515404, 17632456, 17785366, 17896177, 17910759, 17938160, 18214058, 18217976, 18319313, 18327638, 18425577, 18463976, 18483177, 18557990, 18631401, 18632608, 18824499, 18979234, 18980792, 19028704, 19067762, 19117995, 19276248, 19381686, 19385968, 19411863, 19574781, 19585237, 19706809, 19733895, 19771508, 19795205, 19861523, 1988075, 19898223, 19898421, 19949674, 20025731, 20060718, 2018353, 20403033, 20404251, 20419820, 20635137, 20665103, 20679727, 20813970, 20818337, 20863372, 21043825, 21179495, 21229402, 21306611, 21358618, 21527583, 21630023, 21643691, 21652577, 21668473, 21761348, 21761402, 21769435, 21825015, 21847643, 21901488, 21912605, 21919130, 21972997, 22037828, 22053997, 2208151, 22173289, 22287721, 22295114, 22341523, 22396492, 22461912, 22559974, 22607768, 22631661, 22699783, 22751119, 22898337, 22929433, 22987970, 23035882, 23060300, 23098526, 23133541, 23184080, 23220842, 23222299, 23233704, 23270421, 23339407, 23340303, 23412097, 23420063, 23548208, 23640060, 2364377, 23765060, 23888956, 23912957, 23939688, 23977306, 23996067, 24036662, 24070170, 24108431, 24201803, 24337596, 24377825, 24403187, 24488617, 24509169, 24521995, 24670917, 24777335, 24794928, 24843314, 24912489, 24938375, 25053278, 25058880, 25070479, 25255861, 25326397, 25520392, 25528056, 25600243, 25618258, 25674240, 25701109, 25723513, 2576982, 25880075, 25882602, 25895611, 25924995, 25979597, 26065870, 26266392, 26428028, 26472348, 26531187, 26552431, 26749282, 26859414, 26937802, 2696563, 27079770, 27141101, 27183356, 27185370, 27357606, 27386569, 27424567, 27431784, 27447970, 27477822, 27479811, 27542969, 27581495, 27762648, 27768589, 27834468, 27901576, 27986121, 28030809, 28052940, 28057031, 28064383, 28078827, 28122895, 28133688, 28147315, 28165014, 28173783, 28243121, 28251385, 28365833, 28365955, 28378571, 28416639, 28416776, 28467815, 28472813, 28476021, 28480663, 28498427, 28501763, 28534357, 28534358, 28560596, 28586788, 28589369, 28589382, 28607590, 28610873, 28661760, 28684637, 28689363, 28690652, 28701017, 28714765, 28724391, 28729413, 28730256, 28766230, 28789455, 28825136, 28839123, 28843709, 28882624, 28885360, 28888581, 28899737, 28903991, 28911153, 28957821, 28975433, 28982039, 28990139, 29029640, 29051317, 29062076, 29086231, 29094395, 29102782, 29116004, 29117498, 29128898, 29132565, 29134301, 29135104, 29135722, 29144542, 29178258, 29198300, 29212167, 29237804, 29254147, 29254793, 29261144, 29278880, 29284000, 29331723, 29351560, 29392542, 29434968, 29471794, 29491076, 29516374, 29528718, 29553955, 29582173, 29625565, 29673111, 29716928, 29729689, 29763465, 29772460, 29805613, 29858579, 29866663, 29877575, 29881286, 29881297, 29904427, 29931120, 29963112, 29987610, 30031954, 30033447, 30127983, 30171067, 30196425, 30224719, 3023063, 30250578, 30278574, 30279965, 30412123, 30428390, 30479097, 30498371, 30504372, 30509870, 30511789, 30546427, 30546463, 30595493, 30614867, 30627023, 30675282, 30793198, 30806788, 30858726, 30916428, 30936295, 30941738, 30977026, 30993643, 31010819, 31028192, 31066241, 31143231, 31213902, 31219817, 31234641, 31276668, 31332233, 31404155, 31438969, 31512725, 31519397, 31519449, 31523581, 31566192, 31572543, 31588183, 31620243, 31637512, 31689877, 31804368, 3559726, 3873417, 7496840, 7501116, 7532148, 7612493, 7615353, 7675778, 7812959, 7926058, 7927940, 7932810, 7989041, 7999260, 8018954, 8043492, 8049459, 8099571, 8102535, 8105035, 8156519, 8333481, 8379528, 8443766, 8443810, 8471553, 8532698, 8603052, 8625078, 8722747, 8919544, 8944071, 8973592, 9010317, 9389930, 9402587, 9421359, 9467590, 9527274, 9635570, 9646036, 9652611, 9663595, 9669814, 9815730, 9816285, 9865902, 9893667		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	19173015		★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	30845294	Associate	★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	9143583		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	15606754	Associate	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	LHGDN	19061285		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	30101131, 30926428		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	17393410		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	17393410		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	17393410, 27931045		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	30687635, 31024808		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19706809, 21179495, 21524465, 21600232, 26892043		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	12037031, 12825853, 19381686, 19657752, 21092257, 24275214, 24862985, 26111975, 26384318, 28084333, 28178722, 28595965, 30338425, 30383678, 30403906, 9893652		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21191117, 26546331, 35816477	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	23222299, 28052940, 29357906, 31220580, 31403177		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	28052940, 28476021, 40527014	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	30479097	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	15821116, 15868434, 16645950, 18631401, 19380452, 22331459, 23971947, 24300977, 24549642, 26356672, 26458823, 27729416, 28404930, 28690652, 30080878, 30841783, 31403177, 31733575, 31755998, 31805393		★☆☆☆☆ Found in Text Mining only
Olfactory Groove Meningioma	Olfactory Groove Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	18681990		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	28582368		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	18081879	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	11668524, 12038703, 31495455, 7880723		★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	29044863		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	20979607, 22547541, 22977660, 30728052	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	29629944	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	31115963		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11323389, 14769635, 15579801, 15632380, 15718480, 16360811, 18219286, 18319313, 18384825, 20869977, 24057181, 24197980, 25228088, 28264438, 28415663, 29137401, 29885789, 30325501, 31616183, 9816065		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15632380, 18219286		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10318951, 36430718	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10823139, 15718480, 16138714, 18219286, 19383883, 20547493, 21131918, 21799864, 23574718, 23706170, 23845225, 25591549, 26493064, 26577046, 26916548, 26937756, 27139372, 27720231, 28264438, 28416763, 29187928, 30325501, 31495455, 33755733, 33817715, 33891016, 34711431, 35387670, 36867576, 37169775, 37569592, 38013666, 7640219	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	1325950	Stimulate	★☆☆☆☆ Found in Text Mining only
OVERLAP CONNECTIVE TISSUE DISEASE	MASS syndrome	BEFREE	28871061		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	9278646		★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic Cyst	BEFREE	30547767		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	15219637		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	LHGDN	15219637		★☆☆☆☆ Found in Text Mining only
Papillary Meningioma	Papillary Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25862786, 28589382		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	25886293, 30101131		★☆☆☆☆ Found in Text Mining only
Parasagittal Meningioma	Parasagittal Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	19267271		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	19267271	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30290775		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30290775		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	19401830	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	16580389, 17919323, 20826587, 24405633, 25603724, 29535146, 30210706, 30551411		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	17919323, 36286390	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38069013	Stimulate	★☆☆☆☆ Found in Text Mining only
Posterior Fossa Meningioma	Fossa Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Progesterone Resistance	Progesterone Resistance	BEFREE	10946900, 16406281, 19001520, 19389829, 20104427, 20108182, 22259059, 22271293, 24405633, 26036904, 26917262, 28423456, 28424251, 29762665, 29934050, 30483911, 30782101, 30809650, 30994890		★☆☆☆☆ Found in Text Mining only
Progesterone Resistance	Progesterone Resistance	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	24053619	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11280747, 11536308, 12770752, 15330195, 19147544, 25723513, 27125450, 30054508, 31783154		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	32102520	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15178346, 15330195, 25535400, 25723513, 26553226, 32102520, 33370412, 34572596	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	19147544		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24664419	Inhibit	★☆☆☆☆ Found in Text Mining only
Psammomatous Meningioma	Psammomatous Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11194191		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	11194191	Associate	★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	BEFREE	21107812		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30015972		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	33258708	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	14570589, 19555469		★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	15361203	Associate	★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	15863658		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	27087608		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	29385707	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	30829727		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	30829727	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Endometrial Stromal	Endometrial stromal sarcoma	Pubtator	15309019, 25991737	Associate	★☆☆☆☆ Found in Text Mining only
Secretory meningioma	Secretory Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Secretory meningioma	Secretory Meningioma	BEFREE	30503291		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	27061526	Associate	★☆☆☆☆ Found in Text Mining only
Sex Cord-Stromal Tumor	Sex Cord-Stromal Tumor	BEFREE	29137401		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	25994573	Associate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	31917424	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	29972220	Associate	★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	24713395		★☆☆☆☆ Found in Text Mining only
Sphenoid Wing Meningioma	Sphenoid Wing Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Sphenoid Wing Meningioma	Sphenoid Wing Meningioma	BEFREE	28582368		★☆☆☆☆ Found in Text Mining only
Spinal Meningioma	Spinal Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Spinal Meningioma	Spinal Meningioma	BEFREE	31290345		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	16477637, 17896177, 9652611		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28236344, 31696459, 37592311	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	29582173		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23110082		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15309708, 23199240, 27893427	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	33592140	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31644578		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31644578		★☆☆☆☆ Found in Text Mining only
Transitional Meningioma	Transitional Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	17146782, 21830158, 22006997, 23039971, 23555923, 24026994, 25104201, 25413873, 25453096, 25973113, 26752006, 27129866, 27487152, 27502396, 28954821, 30335837, 33057161, 34609409, 35603379, 35875026	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	17764565, 21437249, 21840613, 22427740, 23124476, 23188436, 24008095, 24409301, 24581278, 24721635, 25701109, 26163605, 26280679, 27859250, 29728051, 30613307, 31395590, 32012648, 39193850	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	19901010, 20664514, 20861225, 21161370, 21394499, 21396117, 21421115, 21717460, 21983489, 22006997, 22010008, 22263793, 22446188, 22930220, 23012297, 23171949, 23172894, 23340303, 23400579, 23456737, 23555923, 23696021, 23824750, 23979844, 23988612, 24126575, 24188694, 24236784, 24282978, 24298072, 24477977, 24634415, 24642040, 24670641, 24786829, 24882351, 24884785, 24982892, 25016158, 25033833, 25300558, 25310144, 25356777, 25420519, 25453096, 25527230, 25566982, 25571912, 25611337, 25687182, 25748387, 25822021, 25880075, 25928379, 26009308, 26112095, 26177331, 26280679, 26443806, 26458489, 26694831, 26781859, 26826118, 26950360, 27137755, 27393618, 27589736, 27765921, 27775705, 27902967, 27994514, 28006062, 28036267, 28189497, 28248089, 28253390, 28388298, 28415749, 28421181, 28422142, 28423644, 28435291, 28438385, 28521427, 28707744, 28717401, 28734944, 28735300, 28756019, 28870998, 28941134, 28961506, 28961844, 29069872, 29115931, 29134467, 29196918, 29217458, 29228549, 29250179, 29261141, 29261144, 29281678, 29282680, 29323875, 29330856, 29393238, 29393914, 29512727, 29547591, 29587339, 29633513, 29902579, 29921827, 29978332, 30090017, 30100993, 30186165, 30203490, 30223270, 30227653, 30267987, 30289981, 30293712, 30321870, 30335837, 30338035, 30346453, 30388728, 30419345, 30450577, 30563138, 30628707, 30660004, 30791936, 30796353, 30867801, 30867840, 31011629, 31088482, 31257479, 31261818, 31348739, 31416135, 31456192, 31570423, 31588230, 31704972, 31707383, 31761352, 31786854		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	31522348	Associate	★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	15637090		★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	27635763	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	21972997, 29237804		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	19858087	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	40362654	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15361203	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	40362654	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine Diseases	BEFREE	18280760		★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	21709441, 25144715, 25856298, 34162378, 40702758	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	12065682, 12413982, 12552233, 15807882, 16357844, 17224149, 17522428, 17785366, 18691687, 19176543, 19240151, 19499404, 20124487, 20601542, 21672608, 22350293, 24324590, 26715264, 28169130, 28185997, 28203428, 28637297, 28697115, 29274830, 29630404, 29729689, 29741640, 30390345, 30539001, 30567472, 30865281, 31288815, 31452763, 31504629, 31754172, 7775635, 8187322, 8333481, 9159448, 9253340		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	19782484	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation, Paroxysmal Familial, 1	Ventricular Fibrillation	BEFREE	16807280		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	29382742		★☆☆☆☆ Found in Text Mining only
Xanthomatous Meningioma	Xanthomatous Meningioma	CTD_human_DG	19731987, 19747051, 8008172		★☆☆☆☆ Found in Text Mining only