Gene Gene information from NCBI Gene database.
Entrez ID 5229
Gene name Protein geranylgeranyltransferase type I subunit beta
Gene symbol PGGT1B
Synonyms (NCBI Gene)
BGGIGGTI
Chromosome 5
Chromosome location 5q22.3
Summary Protein geranylgeranyltransferase type I (GGTase-I) transfers a geranylgeranyl group to the cysteine residue of candidate proteins containing a C-terminal CAAX motif in which `A` is an aliphatic amino acid and `X` is leucine (summarized by Zhang et al., 1
miRNA miRNA information provided by mirtarbase database.
298
miRTarBase ID miRNA Experiments Reference
MIRT022675 hsa-miR-124-3p Microarray 18668037
MIRT053412 hsa-miR-591 Microarray 23807165
MIRT438832 hsa-miR-582-5p qRT-PCR 23295946
MIRT438821 hsa-miR-582-3p qRT-PCR 23295946
MIRT438832 hsa-miR-582-5p qRT-PCR 23295946
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0003824 Function Catalytic activity IEA
GO:0004659 Function Prenyltransferase activity IEA
GO:0004661 Function Protein geranylgeranyltransferase activity IDA 16893176
GO:0004661 Function Protein geranylgeranyltransferase activity IEA
GO:0004662 Function CAAX-protein geranylgeranyltransferase activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602031 8895 ENSG00000164219
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P53609
Protein name Geranylgeranyl transferase type-1 subunit beta (EC 2.5.1.59) (Geranylgeranyl transferase type I subunit beta) (GGTase-I-beta) (Type I protein geranyl-geranyltransferase subunit beta)
Protein function Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. Known substrates include RAC1, R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00432 Prenyltrans 142 186 Prenyltransferase and squalene oxidase repeat Repeat
PF00432 Prenyltrans 191 234 Prenyltransferase and squalene oxidase repeat Repeat
PF00432 Prenyltrans 240 284 Prenyltransferase and squalene oxidase repeat Repeat
PF00432 Prenyltrans 289 333 Prenyltransferase and squalene oxidase repeat Repeat
Sequence
MAATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDM
LDSLDVVNKDDIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPFNPSKAPGTAHPYDSG
HIAMTYTGLSCLVILGDDLSRVNKEACLAGLRALQLEDGSFCAVPEGSENDMRFVYCASC
ICYMLN
NWSGMDMKKAITYIRRSMSYDNGLAQGAGLESHGGSTFCGIASLCLMGKLEEVF
SEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATLKLLK
IFQYTNFEKNRNYILS
TQDRLVGGFAKWPDSHPDALHAYFGICGLSLME
ESGICKVHPALNVSTRTSERLLDLHQS
WKTKDSKQCSENVHIST
Sequence length 377
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LUNG NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Colitis Colitis BEFREE 31302143
★☆☆☆☆
Found in Text Mining only
Colon Carcinoma Colon Carcinoma BEFREE 23649168
★☆☆☆☆
Found in Text Mining only
Gout Gout Pubtator 32630231 Associate
★☆☆☆☆
Found in Text Mining only
Inflammatory Bowel Diseases Inflammatory Bowel Disease BEFREE 31302143
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung neoplasms Pubtator 20113484 Inhibit
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Lung Neoplasms Lung Neoplasms CTD_human_DG 22028818
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Lymphopenia Lymphopenia BEFREE 31722972
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of lung Lung Cancer CTD_human_DG 22028818
★☆☆☆☆
Found in Text Mining only
Malignant tumor of colon Colonic Neoplasms BEFREE 23649168
★☆☆☆☆
Found in Text Mining only
Multiple Myeloma Multiple myeloma Pubtator 16156861 Inhibit
★☆☆☆☆
Found in Text Mining only