PGF (placental growth factor)

Gene

• Entrez ID: 5228
• Gene name: Placental growth factor
• Gene symbol: PGF
• Synonyms (NCBI Gene): D12S1900, PGFL, PIGF, PLGF, PlGF-2, SHGC-10760
• Chromosome: 14
• Chromosome location: 14q24.3
• Summary: This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1227362	hsa-miR-214	CLIP-seq
MIRT1227363	hsa-miR-296-5p	CLIP-seq
MIRT1227364	hsa-miR-3185	CLIP-seq
MIRT1227365	hsa-miR-3619-5p	CLIP-seq
MIRT1227366	hsa-miR-3652	CLIP-seq
MIRT1227367	hsa-miR-3918	CLIP-seq
MIRT1227368	hsa-miR-4271	CLIP-seq
MIRT1227369	hsa-miR-4313	CLIP-seq
MIRT1227370	hsa-miR-4420	CLIP-seq
MIRT1227371	hsa-miR-4430	CLIP-seq
MIRT1227372	hsa-miR-4433	CLIP-seq
MIRT1227373	hsa-miR-4505	CLIP-seq
MIRT1227374	hsa-miR-4530	CLIP-seq
MIRT1227375	hsa-miR-4690-5p	CLIP-seq
MIRT1227376	hsa-miR-4709-3p	CLIP-seq
MIRT1227377	hsa-miR-4716-3p	CLIP-seq
MIRT1227378	hsa-miR-4722-5p	CLIP-seq
MIRT1227379	hsa-miR-4725-3p	CLIP-seq
MIRT1227380	hsa-miR-4773	CLIP-seq
MIRT1227381	hsa-miR-4795-5p	CLIP-seq
MIRT1227382	hsa-miR-625	CLIP-seq
MIRT1227383	hsa-miR-634	CLIP-seq
MIRT1227384	hsa-miR-761	CLIP-seq
MIRT1556803	hsa-miR-4768-5p	CLIP-seq
MIRT2066587	hsa-miR-1205	CLIP-seq
MIRT2066588	hsa-miR-1245b-3p	CLIP-seq
MIRT2066589	hsa-miR-1291	CLIP-seq
MIRT2066590	hsa-miR-1909	CLIP-seq
MIRT1227362	hsa-miR-214	CLIP-seq
MIRT2066591	hsa-miR-3155	CLIP-seq
MIRT2066592	hsa-miR-3155b	CLIP-seq
MIRT2066593	hsa-miR-3173-5p	CLIP-seq
MIRT2066594	hsa-miR-328	CLIP-seq
MIRT2066595	hsa-miR-331-3p	CLIP-seq
MIRT2066596	hsa-miR-34a	CLIP-seq
MIRT2066597	hsa-miR-34c-5p	CLIP-seq
MIRT1227365	hsa-miR-3619-5p	CLIP-seq
MIRT2066598	hsa-miR-4261	CLIP-seq
MIRT2066599	hsa-miR-4268	CLIP-seq
MIRT2066600	hsa-miR-4291	CLIP-seq
MIRT2066601	hsa-miR-4299	CLIP-seq
MIRT2066602	hsa-miR-4438	CLIP-seq
MIRT2066603	hsa-miR-4452	CLIP-seq
MIRT2066604	hsa-miR-449a	CLIP-seq
MIRT2066605	hsa-miR-449b	CLIP-seq
MIRT2066606	hsa-miR-4645-5p	CLIP-seq
MIRT2066607	hsa-miR-4673	CLIP-seq
MIRT2066608	hsa-miR-4680-3p	CLIP-seq
MIRT2066609	hsa-miR-484	CLIP-seq
MIRT1227384	hsa-miR-761	CLIP-seq
MIRT2066610	hsa-miR-922	CLIP-seq
MIRT1227362	hsa-miR-214	CLIP-seq
MIRT1227365	hsa-miR-3619-5p	CLIP-seq
MIRT2066598	hsa-miR-4261	CLIP-seq
MIRT2066600	hsa-miR-4291	CLIP-seq
MIRT2294141	hsa-miR-4715-5p	CLIP-seq
MIRT1227384	hsa-miR-761	CLIP-seq
MIRT2066610	hsa-miR-922	CLIP-seq
MIRT2687725	hsa-miR-1207-3p	CLIP-seq
MIRT2687726	hsa-miR-3064-5p	CLIP-seq
MIRT2066591	hsa-miR-3155	CLIP-seq
MIRT2066592	hsa-miR-3155b	CLIP-seq
MIRT2687727	hsa-miR-3160-3p	CLIP-seq
MIRT2066595	hsa-miR-331-3p	CLIP-seq
MIRT2687728	hsa-miR-4252	CLIP-seq
MIRT2066599	hsa-miR-4268	CLIP-seq
MIRT2687729	hsa-miR-4286	CLIP-seq
MIRT2687730	hsa-miR-4297	CLIP-seq
MIRT2066601	hsa-miR-4299	CLIP-seq
MIRT2066602	hsa-miR-4438	CLIP-seq
MIRT2687731	hsa-miR-4487	CLIP-seq
MIRT2066606	hsa-miR-4645-5p	CLIP-seq
MIRT2687732	hsa-miR-4663	CLIP-seq
MIRT2066607	hsa-miR-4673	CLIP-seq
MIRT2066609	hsa-miR-484	CLIP-seq
MIRT2687733	hsa-miR-558	CLIP-seq
MIRT2687734	hsa-miR-892b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GCM1	Activation	18160678
MTF1	Unknown	19956853
STAT3	Repression	23042533

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001666	Process	Response to hypoxia	IBA
GO:0002040	Process	Sprouting angiogenesis	IBA
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	14684734, 20660291
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0007165	Process	Signal transduction	TAS	9467961
GO:0007267	Process	Cell-cell signaling	TAS	9467961
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	IMP	21215706
GO:0008083	Function	Growth factor activity	TAS	9467961
GO:0008201	Function	Heparin binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	21215706
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	9467961
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IBA
GO:0042056	Function	Chemoattractant activity	IBA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IBA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0050918	Process	Positive chemotaxis	IEA
GO:0050930	Process	Induction of positive chemotaxis	IBA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IBA

Other IDs

• MIM: 601121
• HGNC: 8893
• e!Ensembl: ENSG00000119630

Protein

• UniProt ID: P49763
• Protein name: Placenta growth factor (PlGF)
• Protein function: Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. A
• PDB: 1FZV, 1RV6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00341	PDGF	52 → 130	PDGF/VEGF domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: While the three isoforms are present in most placental tissues, PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas.
• Sequence:

  MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVD
  VVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVEL
  TFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWP
  SSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR

• Sequence length: 221

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Pathways in cancer

Reactome:

VEGF ligand-receptor interactions
VEGF binds to VEGFR leading to receptor dimerization

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute fatty liver of pregnancy	Fatty Liver	BEFREE	30141235		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	16146532, 22498340		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17478553, 18316157, 19845534		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16146532		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	21703189		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	29769799, 30534004, 31055948, 31377148		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36680854, 36905877	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	18411415	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	20335221		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	12689930, 12714517, 18411415, 18945963, 21175428, 25403488	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	12689930, 20335221, 20952681, 21175428, 24916507, 25876995, 26460070, 27573019, 27608972, 28823762, 29337222, 31408727		★☆☆☆☆ Found in Text Mining only
Angina Pectoris	Angina pectoris	Pubtator	37787982	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	36435742	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	29062343	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	37787982	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28883908		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19948974, 20500895, 23525413, 25876995, 28397162		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	19180491, 23872401, 24574497, 31406382		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28220848		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	28220848	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	19948974, 20500895, 23525413, 25876995, 28397162		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20500895, 25079461	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29689494, 31301487, 31406382		★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	16146532		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	14666676, 29279353		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	29543340		★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	29543340		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29277778		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17550303, 20043119, 26861455, 31106153, 31562866		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20551949, 26577839, 31562866	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28607365	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial hyperreactivity	Pubtator	18945963	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	23232836	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21703189, 31828297, 33929972, 36157115, 36292719, 36362375	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29277778		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	24946722		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15192305, 17704140, 18615591, 28861767, 29991059		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	29643276	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36272973	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17505508, 17605814, 32469992, 34516333	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	23318994		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26402225, 26824454, 29643276		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	33988313, 36435742	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	12714517	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19091535, 28682476, 29290570		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	33988313, 36875456	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	12454810		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	37679252	Stimulate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	16146532		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	21703189		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35558087	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	16864484		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	10068204, 19022893, 28963486		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31666542, 31807298		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28220848, 29722565		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	17696935		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	36680854	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	15667502	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17704140, 31717527		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	17704140	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15831913, 17704140, 19657001, 23799978, 31063258		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15831913, 19657001, 22363134, 22706737, 23148666, 23799978, 31358848, 31717527, 34965954, 37017587	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	17704140		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17704140		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17704140	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	12598419		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31157982		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10208873, 17505508, 30214613		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19201345		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19201345		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	37787982	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	18927470		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19201345		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	15667502	Stimulate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	29027018		★☆☆☆☆ Found in Text Mining only
Cystathionine beta-Synthase Deficiency Disease	Cystathionine Beta-Synthase Deficiency Disease	BEFREE	11535567		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	11029317, 17382901		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	17382901	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19180491		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31139684		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	37175824	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27527872		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17003476, 31601637		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28112754, 33504861	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17003476, 31322059, 31601637		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36875456	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	34149611	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11378531, 31322059		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	21056561		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	12453985		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	16341703, 27874278, 28965804, 29724654, 30385175, 31055948, 31653890		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	29584759, 32058040, 32290826, 32813141	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	29652651		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	11810642		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	19277983, 35361402	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	23744626, 24192489, 26513650, 26841247		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	10585897, 25132343, 28078815, 28600845, 29115294, 30014562, 30948284, 31240854, 31452230		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	24988221, 27980400	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	17478553, 18316157, 19549892, 20816914		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23232836	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	14645176		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	26773192, 30737365		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	26773192	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29643276		★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	BEFREE	16843105, 18276084		★☆☆☆☆ Found in Text Mining only
Erythroid hyperplasia	Erythroid hyperplasia	BEFREE	20335221		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25213700		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25213700		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	27064391, 29177891, 29769799, 30002400, 30385175, 31055948, 31377148		★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	33599733	Stimulate	★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	12086892		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28301573, 28378526, 28744285		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	31139684		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	29416013, 29575299		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	26968576		★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	BEFREE	31055948		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	8760299		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16618713, 26090865, 28797294		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26090865, 28797294	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16618713, 26090865, 28797294		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	29769799, 30534004, 31055948, 31377148		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	14694045		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	29373603		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31157982		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36435742	Associate	★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	28338787, 28600845, 28737473, 30141235		★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	29027018, 8627342		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	27608972		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	27608972		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	16545687		★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	16545687		★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	BEFREE	27608972		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	39329718	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	22782530, 30361676		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	24913829	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	33660787	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	18411415	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	25403488	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	12808329		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19786649, 20335221, 27489037, 28646507, 28737473, 29173607, 29324984, 29513563, 29569955, 29614308, 29851029, 30144822, 31401877, 31408727, 31416428, 31705883, 31791965		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25583406	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29769799, 33599733, 36362375	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	31100188		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29528272		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	15667502	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	21135203	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	16545687, 24916507, 29543340		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	28397162		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	19948974		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	24471420	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30955944		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	24946722	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	16249383	Associate	★☆☆☆☆ Found in Text Mining only
Lipoblastoma	Lipoblastoma	BEFREE	18276084		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	20515481		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21703189, 26753564, 30214613, 31828297		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	17696935, 31249451		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	35168183	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	35927556	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	15192305, 22593690, 29991059	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18615591		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	25359881, 29689494		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21729304, 29643276	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23660220, 25880726	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28119994		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	28119994		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	20962354, 31731799	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	33599733	Stimulate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	27527872		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	19505392		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17550303, 20043119, 26861455, 31106153, 31562866		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25213700		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	29416013, 29575299		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21703189		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15192305, 18615591, 28861767, 29991059		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26402225, 26824454, 29643276		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14666676, 21323568, 24005860		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29277778		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16618713, 18276084, 19184985, 21109946, 22484977, 22908198, 22963500, 24946722, 25213700, 25297943, 25432135, 25876995, 25895458, 26040765, 26402225, 26418253, 27735991, 28427198, 28682476, 29575299, 30203564, 30214613, 30358224, 30652389, 31828297, 7478581		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31717527		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20043119, 30241030		★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	29569955, 30179860		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10886518, 11121133	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21109946, 26846845		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	10451490		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27527872		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19505392	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29434073		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20649935, 25079461	Stimulate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	26846845		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	21047920, 29685073, 31312859		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	29187730	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	25705681	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	16630991, 19602778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	29062343	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	37787982	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31157982		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	36822023	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10451490, 11948135, 12019148, 12086892, 14519649, 14563949, 15192038, 15831913, 16378246, 16618713, 16754748, 16877362, 16964430, 17431116, 18042800, 18316157, 19845534, 20043119, 20097868, 21224376, 21343374, 21407216, 22484977, 23267058, 23318994, 23441128, 23660220, 23799978, 26416897, 26846845, 26861455, 28119994, 28427198, 28607365, 29512738, 30017791, 30024608, 30214613, 30241030, 30902388, 31216652, 31758648, 7478581		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27669225		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	17611651		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19138967, 26418253, 28861767, 29991059		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25079461	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26861455, 29434073		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37008941	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30214613		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26402225, 26824454, 29643276		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26402225, 26824454, 29643276, 32878513	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21263190, 26584517	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	10783334		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	12598419		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	31232532		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29790168		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	31139684		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	29110608, 31802372		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	25141961	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	20473593		★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	29689494		★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	31249451		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31139684		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	27886182, 30377995, 31802372		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	31659187		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14666676, 21323568, 24005860		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	14666676		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	24005860		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	19168169	Inhibit	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31545526		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	37128643	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18202163, 24988221	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27980400, 28220848	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	23122125, 25186164, 27980400, 29722565		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10208873, 30214613		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	16341703, 30385175, 31055948		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	30298670		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	30024608		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	30024608	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	30073769		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19180491, 23872401, 24574497, 25694608		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22963500		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	21407216		★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	BEFREE	21056561		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	30928393		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	15192305		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	15192305	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19845534, 23660220		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23660220, 25432135, 29149180	Associate	★☆☆☆☆ Found in Text Mining only
Subcortical Vascular Dementia	Subcortical Vascular Dementia	BEFREE	31139684		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29528272		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	8760299		★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	18411415	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	20473593, 20615083		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	26040765, 7478581		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	7478581		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26040765, 30272326	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	18061661		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28607365		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28607365	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36822023	Associate	★☆☆☆☆ Found in Text Mining only
Trisomy	Trisomy	Pubtator	32621353	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	24988221	Associate	★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner syndrome	Pubtator	19277983	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30358224, 33888644	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25674215, 33109108	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	22555639	Inhibit	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	30824385	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	28220848	Associate	★☆☆☆☆ Found in Text Mining only