Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5210
Gene name	6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4
Gene symbol	PFKFB4
Synonyms (NCBI Gene)	-
Chromosome	3
Chromosome location	3p21.31
Summary	The protein encoded by this gene is one of four bifunctional kinase/phosphatases that regulate the concentration of the glycolytic byproduct fructose-2,6-bisphosphate (F2,6BP). The encoded protein is highly expressed in cancer cells and is induced by hypo

158

Show/Hide all (158)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016861	hsa-miR-335-5p	Microarray	18185580
MIRT040714	hsa-miR-92b-3p	CLASH	23622248
MIRT1226376	hsa-miR-214	CLIP-seq
MIRT1226377	hsa-miR-23a	CLIP-seq
MIRT1226378	hsa-miR-23b	CLIP-seq
MIRT1226379	hsa-miR-23c	CLIP-seq
MIRT1226380	hsa-miR-2467-3p	CLIP-seq
MIRT1226381	hsa-miR-296-3p	CLIP-seq
MIRT1226382	hsa-miR-3124-3p	CLIP-seq
MIRT1226383	hsa-miR-3138	CLIP-seq
MIRT1226384	hsa-miR-323-5p	CLIP-seq
MIRT1226385	hsa-miR-3619-5p	CLIP-seq
MIRT1226386	hsa-miR-3687	CLIP-seq
MIRT1226387	hsa-miR-4436b-3p	CLIP-seq
MIRT1226388	hsa-miR-4442	CLIP-seq
MIRT1226389	hsa-miR-450b-3p	CLIP-seq
MIRT1226390	hsa-miR-4520a-3p	CLIP-seq
MIRT1226391	hsa-miR-4685-5p	CLIP-seq
MIRT1226392	hsa-miR-4713-3p	CLIP-seq
MIRT1226393	hsa-miR-4755-3p	CLIP-seq
MIRT1226394	hsa-miR-4786-5p	CLIP-seq
MIRT1226395	hsa-miR-591	CLIP-seq
MIRT1226396	hsa-miR-638	CLIP-seq
MIRT1226397	hsa-miR-658	CLIP-seq
MIRT1226398	hsa-miR-761	CLIP-seq
MIRT1226399	hsa-miR-769-3p	CLIP-seq
MIRT2066293	hsa-miR-1184	CLIP-seq
MIRT2066294	hsa-miR-1205	CLIP-seq
MIRT2066295	hsa-miR-1226	CLIP-seq
MIRT2066296	hsa-miR-1276	CLIP-seq
MIRT2066297	hsa-miR-15a	CLIP-seq
MIRT2066298	hsa-miR-15b	CLIP-seq
MIRT2066299	hsa-miR-16	CLIP-seq
MIRT2066300	hsa-miR-1910	CLIP-seq
MIRT2066301	hsa-miR-195	CLIP-seq
MIRT2066302	hsa-miR-2278	CLIP-seq
MIRT2066303	hsa-miR-2355-5p	CLIP-seq
MIRT2066304	hsa-miR-2861	CLIP-seq
MIRT2066305	hsa-miR-3158-5p	CLIP-seq
MIRT2066306	hsa-miR-424	CLIP-seq
MIRT1226390	hsa-miR-4520a-3p	CLIP-seq
MIRT2066307	hsa-miR-4524	CLIP-seq
MIRT2066308	hsa-miR-4642	CLIP-seq
MIRT2066309	hsa-miR-4672	CLIP-seq
MIRT1226391	hsa-miR-4685-5p	CLIP-seq
MIRT1226392	hsa-miR-4713-3p	CLIP-seq
MIRT2066310	hsa-miR-497	CLIP-seq
MIRT2066311	hsa-miR-513b	CLIP-seq
MIRT2066312	hsa-miR-518a-5p	CLIP-seq
MIRT2066313	hsa-miR-527	CLIP-seq
MIRT2066295	hsa-miR-1226	CLIP-seq
MIRT2293779	hsa-miR-1229	CLIP-seq
MIRT2293780	hsa-miR-146b-3p	CLIP-seq
MIRT2066297	hsa-miR-15a	CLIP-seq
MIRT2066298	hsa-miR-15b	CLIP-seq
MIRT2066299	hsa-miR-16	CLIP-seq
MIRT2066301	hsa-miR-195	CLIP-seq
MIRT1226376	hsa-miR-214	CLIP-seq
MIRT2066302	hsa-miR-2278	CLIP-seq
MIRT2293781	hsa-miR-3150a-3p	CLIP-seq
MIRT2293782	hsa-miR-3175	CLIP-seq
MIRT2293783	hsa-miR-3184	CLIP-seq
MIRT1226385	hsa-miR-3619-5p	CLIP-seq
MIRT2293784	hsa-miR-3663-5p	CLIP-seq
MIRT2293785	hsa-miR-423-5p	CLIP-seq
MIRT2066306	hsa-miR-424	CLIP-seq
MIRT2293786	hsa-miR-4287	CLIP-seq
MIRT2293787	hsa-miR-4313	CLIP-seq
MIRT2293788	hsa-miR-4457	CLIP-seq
MIRT2293789	hsa-miR-4469	CLIP-seq
MIRT2293790	hsa-miR-4488	CLIP-seq
MIRT1226390	hsa-miR-4520a-3p	CLIP-seq
MIRT2293791	hsa-miR-4522	CLIP-seq
MIRT2066307	hsa-miR-4524	CLIP-seq
MIRT2293792	hsa-miR-4667-5p	CLIP-seq
MIRT2293793	hsa-miR-4685-3p	CLIP-seq
MIRT2293794	hsa-miR-4697-5p	CLIP-seq
MIRT2293795	hsa-miR-4700-5p	CLIP-seq
MIRT2293796	hsa-miR-4728-5p	CLIP-seq
MIRT2293797	hsa-miR-4731-3p	CLIP-seq
MIRT2293798	hsa-miR-4733-3p	CLIP-seq
MIRT2293799	hsa-miR-4801	CLIP-seq
MIRT2066310	hsa-miR-497	CLIP-seq
MIRT2293800	hsa-miR-503	CLIP-seq
MIRT2293801	hsa-miR-622	CLIP-seq
MIRT2293802	hsa-miR-646	CLIP-seq
MIRT1226398	hsa-miR-761	CLIP-seq
MIRT2293803	hsa-miR-939	CLIP-seq
MIRT2066293	hsa-miR-1184	CLIP-seq
MIRT2591861	hsa-miR-1202	CLIP-seq
MIRT2066294	hsa-miR-1205	CLIP-seq
MIRT2066295	hsa-miR-1226	CLIP-seq
MIRT2591862	hsa-miR-197	CLIP-seq
MIRT2066302	hsa-miR-2278	CLIP-seq
MIRT1226380	hsa-miR-2467-3p	CLIP-seq
MIRT2591863	hsa-miR-30a	CLIP-seq
MIRT2591864	hsa-miR-30b	CLIP-seq
MIRT2591865	hsa-miR-30c	CLIP-seq
MIRT2591866	hsa-miR-30d	CLIP-seq
MIRT2591867	hsa-miR-30e	CLIP-seq
MIRT2066305	hsa-miR-3158-5p	CLIP-seq
MIRT2591868	hsa-miR-3194-5p	CLIP-seq
MIRT2591869	hsa-miR-3607-3p	CLIP-seq
MIRT2591870	hsa-miR-3654	CLIP-seq
MIRT2591871	hsa-miR-3678-3p	CLIP-seq
MIRT2591872	hsa-miR-378	CLIP-seq
MIRT2591873	hsa-miR-378b	CLIP-seq
MIRT2591874	hsa-miR-378c	CLIP-seq
MIRT2591875	hsa-miR-378d	CLIP-seq
MIRT2591876	hsa-miR-378e	CLIP-seq
MIRT2591877	hsa-miR-378f	CLIP-seq
MIRT2591878	hsa-miR-378h	CLIP-seq
MIRT2591879	hsa-miR-378i	CLIP-seq
MIRT2591880	hsa-miR-3922-5p	CLIP-seq
MIRT2591881	hsa-miR-3972	CLIP-seq
MIRT2591882	hsa-miR-422a	CLIP-seq
MIRT2591883	hsa-miR-4323	CLIP-seq
MIRT2293788	hsa-miR-4457	CLIP-seq
MIRT2591884	hsa-miR-4494	CLIP-seq
MIRT2591885	hsa-miR-4519	CLIP-seq
MIRT2591886	hsa-miR-4640-3p	CLIP-seq
MIRT2591887	hsa-miR-4676-5p	CLIP-seq
MIRT2293798	hsa-miR-4733-3p	CLIP-seq
MIRT2591888	hsa-miR-4753-5p	CLIP-seq
MIRT2591889	hsa-miR-4758-3p	CLIP-seq
MIRT2591890	hsa-miR-4763-5p	CLIP-seq
MIRT2591891	hsa-miR-4776-3p	CLIP-seq
MIRT2591892	hsa-miR-4798-3p	CLIP-seq
MIRT2591893	hsa-miR-5096	CLIP-seq
MIRT2066311	hsa-miR-513b	CLIP-seq
MIRT2591894	hsa-miR-515-3p	CLIP-seq
MIRT2591895	hsa-miR-519e	CLIP-seq
MIRT2591896	hsa-miR-550a	CLIP-seq
MIRT2591897	hsa-miR-575	CLIP-seq
MIRT2293801	hsa-miR-622	CLIP-seq
MIRT2066295	hsa-miR-1226	CLIP-seq
MIRT2591862	hsa-miR-197	CLIP-seq
MIRT2591868	hsa-miR-3194-5p	CLIP-seq
MIRT2687692	hsa-miR-3202	CLIP-seq
MIRT2591870	hsa-miR-3654	CLIP-seq
MIRT2591872	hsa-miR-378	CLIP-seq
MIRT2591873	hsa-miR-378b	CLIP-seq
MIRT2591874	hsa-miR-378c	CLIP-seq
MIRT2591875	hsa-miR-378d	CLIP-seq
MIRT2591876	hsa-miR-378e	CLIP-seq
MIRT2591877	hsa-miR-378f	CLIP-seq
MIRT2591878	hsa-miR-378h	CLIP-seq
MIRT2591879	hsa-miR-378i	CLIP-seq
MIRT2591880	hsa-miR-3922-5p	CLIP-seq
MIRT2591882	hsa-miR-422a	CLIP-seq
MIRT2293788	hsa-miR-4457	CLIP-seq
MIRT2687693	hsa-miR-4533	CLIP-seq
MIRT2293798	hsa-miR-4733-3p	CLIP-seq
MIRT2591888	hsa-miR-4753-5p	CLIP-seq
MIRT2687694	hsa-miR-4790-3p	CLIP-seq
MIRT2591892	hsa-miR-4798-3p	CLIP-seq
MIRT2591893	hsa-miR-5096	CLIP-seq
MIRT2066311	hsa-miR-513b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
HIF1A	Unknown	16311927

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0003873	Function	6-phosphofructo-2-kinase activity	IBA
GO:0003873	Function	6-phosphofructo-2-kinase activity	IEA
GO:0003873	Function	6-phosphofructo-2-kinase activity	NAS	10095107
GO:0004331	Function	Fructose-2,6-bisphosphate 2-phosphatase activity	IBA
GO:0004331	Function	Fructose-2,6-bisphosphate 2-phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006000	Process	Fructose metabolic process	IEA
GO:0006003	Process	Fructose 2,6-bisphosphate metabolic process	IBA
GO:0006003	Process	Fructose 2,6-bisphosphate metabolic process	IEA
GO:0006003	Process	Fructose 2,6-bisphosphate metabolic process	ISS
GO:0006094	Process	Gluconeogenesis	NAS	15581487
GO:0006096	Process	Glycolytic process	NAS	15581487
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0043540	Component	6-phosphofructo-2-kinase/fructose-2,6-biphosphatase complex	ISS
GO:0046835	Process	Carbohydrate phosphorylation	IEA

MIM	HGNC	e!Ensembl
605320	8875	ENSG00000114268

Q16877

Protein name

6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 (6PF-2-K/Fru-2,6-P2ase 4) (PFK/FBPase 4) (6PF-2-K/Fru-2,6-P2ase testis-type isozyme) [Includes: 6-phosphofructo-2-kinase (EC 2.7.1.105); Fructose-2,6-bisphosphatase (EC 3.1.3.46)]

Protein function

Synthesis and degradation of fructose 2,6-bisphosphate.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01591	6PF2K	28 → 249	6-phosphofructo-2-kinase	Domain
PF00300	His_Phos_1	252 → 438	Histidine phosphatase superfamily (branch 1)	Domain

Sequence

MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPARGKTYISKKLT
RYLNWIGVPTREFNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVRRFLSE
EGGHVAVFDATNTTRERRATIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYV
NRDSDEATEDFMRRIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVY
YLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFAKSLAQFISDQNIKDLKVW
TSQMKRTIQTAEALGVPYEQWKVLNEIDAGVCEEMTYEEIQDNYPLEFALRDQDKYRYRY
PKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEQLPYLKCPLHTV
LKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPPEEALVTVPAHQ

Sequence length

469

Interactions

View interactions

	KEGG		Reactome
	Fructose and mannose metabolism Metabolic pathways AMPK signaling pathway		Regulation of glycolysis by fructose 2,6-bisphosphate metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (50)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Astrocytoma	Astrocytoma	BEFREE	31369092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26980488, 27181362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29615789, 30415245, 30613295, 31244553		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	35659173	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37222403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34211613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33407546, 36806581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26980488, 27181362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	26832214	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37500615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney complex	Pubtator	35902861	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37770581	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36109523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31369092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34234350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31369092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22056879, 30415245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35659173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	39595571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15474002, 23840896, 34445551, 37892173	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35813480, 36806581, 37179372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	31244553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16025159, 21640852, 27769068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16025159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development, Group II	Malformation of cortical development	BEFREE	29038306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25320508, 29615789, 30415245, 30613295, 31244553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25320508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17143338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15474002, 22576210, 30415245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17143338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26980488, 27181362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15474002, 16025159, 22056879, 25320508, 26221874, 27181362, 29208667, 30415245, 30613295, 31369092, 31754349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29615789		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30504385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	34445551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	22576210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22576210, 26221874, 30415245, 30613295, 31369092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	40148931	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17143338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17143338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15474002, 22576210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15474002, 25772235, 32487245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	32143590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	32764642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	29208667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	17143338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34211613	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26980488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33228592, 35659173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PFKFB4 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4)