Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5209
Gene name	6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
Gene symbol	PFKFB3
Synonyms (NCBI Gene)	IPFK2PFK2iPFK-2
Chromosome	10
Chromosome location	10p15.1
Summary	The protein encoded by this gene belongs to a family of bifunctional proteins that are involved in both the synthesis and degradation of fructose-2,6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-p

371

Show/Hide all (371)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028775	hsa-miR-26b-5p	Microarray	19088304
MIRT043840	hsa-miR-330-3p	CLASH	23622248
MIRT527976	hsa-miR-6865-3p	PAR-CLIP	22012620
MIRT527975	hsa-miR-6840-5p	PAR-CLIP	22012620
MIRT527974	hsa-miR-6892-3p	PAR-CLIP	22012620
MIRT527973	hsa-miR-3185	PAR-CLIP	22012620
MIRT454764	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT454763	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT454762	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT454761	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT454760	hsa-miR-765	PAR-CLIP	23592263
MIRT454759	hsa-miR-1291	PAR-CLIP	23592263
MIRT454758	hsa-miR-6775-3p	PAR-CLIP	23592263
MIRT454757	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT454756	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT454755	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT454754	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT454753	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT454752	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT454751	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT454750	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT454749	hsa-miR-3689c	PAR-CLIP	23592263
MIRT454747	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT454748	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT454755	hsa-miR-1233-5p	PAR-CLIP	26701625
MIRT454755	hsa-miR-1233-5p	PAR-CLIP	26701625
MIRT454755	hsa-miR-1233-5p	PAR-CLIP	26701625
MIRT454753	hsa-miR-1273h-5p	PAR-CLIP	26701625
MIRT454753	hsa-miR-1273h-5p	PAR-CLIP	26701625
MIRT454753	hsa-miR-1273h-5p	PAR-CLIP	26701625
MIRT454759	hsa-miR-1291	PAR-CLIP	26701625
MIRT454759	hsa-miR-1291	PAR-CLIP	26701625
MIRT454759	hsa-miR-1291	PAR-CLIP	26701625
MIRT454752	hsa-miR-30b-3p	PAR-CLIP	26701625
MIRT454752	hsa-miR-30b-3p	PAR-CLIP	26701625
MIRT454752	hsa-miR-30b-3p	PAR-CLIP	26701625
MIRT454762	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT454762	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT454762	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT454751	hsa-miR-3689a-3p	PAR-CLIP	26701625
MIRT454751	hsa-miR-3689a-3p	PAR-CLIP	26701625
MIRT454751	hsa-miR-3689a-3p	PAR-CLIP	26701625
MIRT454750	hsa-miR-3689b-3p	PAR-CLIP	26701625
MIRT454750	hsa-miR-3689b-3p	PAR-CLIP	26701625
MIRT454750	hsa-miR-3689b-3p	PAR-CLIP	26701625
MIRT454749	hsa-miR-3689c	PAR-CLIP	26701625
MIRT454749	hsa-miR-3689c	PAR-CLIP	26701625
MIRT454749	hsa-miR-3689c	PAR-CLIP	26701625
MIRT454761	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT454761	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT454761	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT454764	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT454764	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT454764	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT454758	hsa-miR-6775-3p	PAR-CLIP	26701625
MIRT454758	hsa-miR-6775-3p	PAR-CLIP	26701625
MIRT454758	hsa-miR-6775-3p	PAR-CLIP	26701625
MIRT454754	hsa-miR-6778-5p	PAR-CLIP	26701625
MIRT454754	hsa-miR-6778-5p	PAR-CLIP	26701625
MIRT454754	hsa-miR-6778-5p	PAR-CLIP	26701625
MIRT454747	hsa-miR-6779-5p	PAR-CLIP	26701625
MIRT454747	hsa-miR-6779-5p	PAR-CLIP	26701625
MIRT454747	hsa-miR-6779-5p	PAR-CLIP	26701625
MIRT454748	hsa-miR-6780a-5p	PAR-CLIP	26701625
MIRT454748	hsa-miR-6780a-5p	PAR-CLIP	26701625
MIRT454748	hsa-miR-6780a-5p	PAR-CLIP	26701625
MIRT454756	hsa-miR-6799-5p	PAR-CLIP	26701625
MIRT454756	hsa-miR-6799-5p	PAR-CLIP	26701625
MIRT454756	hsa-miR-6799-5p	PAR-CLIP	26701625
MIRT454763	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT454763	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT454763	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT454757	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT454757	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT454757	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT454760	hsa-miR-765	PAR-CLIP	26701625
MIRT454760	hsa-miR-765	PAR-CLIP	26701625
MIRT454760	hsa-miR-765	PAR-CLIP	26701625
MIRT732446	hsa-miR-675-5p	ImmunofluorescenceImmunohistochemistry (IHC)qRT-PCRWestern blotting	33762576
MIRT733774	hsa-miR-488-5p	Luciferase reporter assayqRT-PCR	32990355
MIRT737237	hsa-miR-3666	Luciferase reporter assayWestern blottingqRT-PCR	32982293
MIRT527976	hsa-miR-6865-3p	PAR-CLIP	22012620
MIRT527975	hsa-miR-6840-5p	PAR-CLIP	22012620
MIRT527974	hsa-miR-6892-3p	PAR-CLIP	22012620
MIRT527973	hsa-miR-3185	PAR-CLIP	22012620
MIRT454764	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT454763	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT454762	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT454761	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT454760	hsa-miR-765	PAR-CLIP	23592263
MIRT454759	hsa-miR-1291	PAR-CLIP	23592263
MIRT454758	hsa-miR-6775-3p	PAR-CLIP	23592263
MIRT454757	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT454756	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT454755	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT454754	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT454753	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT454752	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT454751	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT454750	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT454749	hsa-miR-3689c	PAR-CLIP	23592263
MIRT454747	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT454748	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT756385	hsa-miR-1915-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)	34599680
MIRT1226254	hsa-miR-106a	CLIP-seq
MIRT1226255	hsa-miR-106b	CLIP-seq
MIRT1226256	hsa-miR-1197	CLIP-seq
MIRT1226257	hsa-miR-1247	CLIP-seq
MIRT1226258	hsa-miR-1254	CLIP-seq
MIRT1226259	hsa-miR-1266	CLIP-seq
MIRT1226260	hsa-miR-1286	CLIP-seq
MIRT1226261	hsa-miR-130a	CLIP-seq
MIRT1226262	hsa-miR-130b	CLIP-seq
MIRT1226263	hsa-miR-139-5p	CLIP-seq
MIRT1226264	hsa-miR-17	CLIP-seq
MIRT1226265	hsa-miR-1827	CLIP-seq
MIRT1226266	hsa-miR-1972	CLIP-seq
MIRT1226267	hsa-miR-19a	CLIP-seq
MIRT1226268	hsa-miR-19b	CLIP-seq
MIRT1226269	hsa-miR-20a	CLIP-seq
MIRT1226270	hsa-miR-20b	CLIP-seq
MIRT1226271	hsa-miR-216b	CLIP-seq
MIRT1226272	hsa-miR-224	CLIP-seq
MIRT1226273	hsa-miR-2467-5p	CLIP-seq
MIRT1226274	hsa-miR-298	CLIP-seq
MIRT1226275	hsa-miR-301a	CLIP-seq
MIRT1226276	hsa-miR-301b	CLIP-seq
MIRT1226277	hsa-miR-3116	CLIP-seq
MIRT1226278	hsa-miR-3160-5p	CLIP-seq
MIRT1226279	hsa-miR-3179	CLIP-seq
MIRT1226280	hsa-miR-3199	CLIP-seq
MIRT1226281	hsa-miR-3612	CLIP-seq
MIRT1226282	hsa-miR-3613-3p	CLIP-seq
MIRT1226283	hsa-miR-3616-3p	CLIP-seq
MIRT1226284	hsa-miR-3664-3p	CLIP-seq
MIRT1226285	hsa-miR-3675-3p	CLIP-seq
MIRT1226286	hsa-miR-3714	CLIP-seq
MIRT1226287	hsa-miR-377	CLIP-seq
MIRT1226288	hsa-miR-3944-5p	CLIP-seq
MIRT1226289	hsa-miR-4266	CLIP-seq
MIRT1226290	hsa-miR-4269	CLIP-seq
MIRT1226291	hsa-miR-4295	CLIP-seq
MIRT1226292	hsa-miR-4302	CLIP-seq
MIRT1226293	hsa-miR-4436a	CLIP-seq
MIRT1226294	hsa-miR-4436b-3p	CLIP-seq
MIRT1226295	hsa-miR-4443	CLIP-seq
MIRT1226296	hsa-miR-4448	CLIP-seq
MIRT1226297	hsa-miR-4457	CLIP-seq
MIRT1226298	hsa-miR-4493	CLIP-seq
MIRT1226299	hsa-miR-4514	CLIP-seq
MIRT1226300	hsa-miR-4518	CLIP-seq
MIRT1226301	hsa-miR-4530	CLIP-seq
MIRT1226302	hsa-miR-454	CLIP-seq
MIRT1226303	hsa-miR-4635	CLIP-seq
MIRT1226304	hsa-miR-4645-5p	CLIP-seq
MIRT1226305	hsa-miR-4648	CLIP-seq
MIRT1226306	hsa-miR-4650-5p	CLIP-seq
MIRT1226307	hsa-miR-4660	CLIP-seq
MIRT1226308	hsa-miR-4673	CLIP-seq
MIRT1226309	hsa-miR-4684-5p	CLIP-seq
MIRT1226310	hsa-miR-4692	CLIP-seq
MIRT1226311	hsa-miR-4695-5p	CLIP-seq
MIRT1226312	hsa-miR-4707-5p	CLIP-seq
MIRT1226313	hsa-miR-4709-3p	CLIP-seq
MIRT1226314	hsa-miR-4717-5p	CLIP-seq
MIRT1226315	hsa-miR-4727-5p	CLIP-seq
MIRT1226316	hsa-miR-4731-3p	CLIP-seq
MIRT1226317	hsa-miR-4747-5p	CLIP-seq
MIRT1226318	hsa-miR-4750	CLIP-seq
MIRT1226319	hsa-miR-4753-5p	CLIP-seq
MIRT1226320	hsa-miR-4755-3p	CLIP-seq
MIRT1226321	hsa-miR-4769-3p	CLIP-seq
MIRT1226322	hsa-miR-4779	CLIP-seq
MIRT1226323	hsa-miR-4789-3p	CLIP-seq
MIRT1226324	hsa-miR-4789-5p	CLIP-seq
MIRT1226325	hsa-miR-4795-5p	CLIP-seq
MIRT1226326	hsa-miR-4801	CLIP-seq
MIRT1226327	hsa-miR-519a	CLIP-seq
MIRT1226328	hsa-miR-519b-3p	CLIP-seq
MIRT1226329	hsa-miR-519c-3p	CLIP-seq
MIRT1226330	hsa-miR-519d	CLIP-seq
MIRT1226331	hsa-miR-548t	CLIP-seq
MIRT1226332	hsa-miR-646	CLIP-seq
MIRT1226333	hsa-miR-648	CLIP-seq
MIRT1226334	hsa-miR-650	CLIP-seq
MIRT1226335	hsa-miR-658	CLIP-seq
MIRT1226336	hsa-miR-9	CLIP-seq
MIRT1226337	hsa-miR-922	CLIP-seq
MIRT1226338	hsa-miR-93	CLIP-seq
MIRT1226339	hsa-miR-940	CLIP-seq
MIRT1226340	hsa-miR-1	CLIP-seq
MIRT1226257	hsa-miR-1247	CLIP-seq
MIRT1226259	hsa-miR-1266	CLIP-seq
MIRT1226341	hsa-miR-1324	CLIP-seq
MIRT1226263	hsa-miR-139-5p	CLIP-seq
MIRT1226342	hsa-miR-150	CLIP-seq
MIRT1226343	hsa-miR-206	CLIP-seq
MIRT1226344	hsa-miR-2110	CLIP-seq
MIRT1226271	hsa-miR-216b	CLIP-seq
MIRT1226272	hsa-miR-224	CLIP-seq
MIRT1226273	hsa-miR-2467-5p	CLIP-seq
MIRT1226274	hsa-miR-298	CLIP-seq
MIRT1226345	hsa-miR-302a	CLIP-seq
MIRT1226346	hsa-miR-302b	CLIP-seq
MIRT1226347	hsa-miR-302c	CLIP-seq
MIRT1226348	hsa-miR-302d	CLIP-seq
MIRT1226349	hsa-miR-302e	CLIP-seq
MIRT1226350	hsa-miR-3127-5p	CLIP-seq
MIRT1226278	hsa-miR-3160-5p	CLIP-seq
MIRT1226284	hsa-miR-3664-3p	CLIP-seq
MIRT1226351	hsa-miR-3673	CLIP-seq
MIRT1226285	hsa-miR-3675-3p	CLIP-seq
MIRT1226352	hsa-miR-3688-3p	CLIP-seq
MIRT1226353	hsa-miR-372	CLIP-seq
MIRT1226354	hsa-miR-373	CLIP-seq
MIRT1226287	hsa-miR-377	CLIP-seq
MIRT1226355	hsa-miR-3918	CLIP-seq
MIRT1226356	hsa-miR-3919	CLIP-seq
MIRT1226289	hsa-miR-4266	CLIP-seq
MIRT1226357	hsa-miR-4271	CLIP-seq
MIRT1226358	hsa-miR-4284	CLIP-seq
MIRT1226359	hsa-miR-4437	CLIP-seq
MIRT1226296	hsa-miR-4448	CLIP-seq
MIRT1226300	hsa-miR-4518	CLIP-seq
MIRT1226360	hsa-miR-4533	CLIP-seq
MIRT1226361	hsa-miR-4667-5p	CLIP-seq
MIRT1226362	hsa-miR-4672	CLIP-seq
MIRT1226309	hsa-miR-4684-5p	CLIP-seq
MIRT1226363	hsa-miR-4694-3p	CLIP-seq
MIRT1226364	hsa-miR-4695-3p	CLIP-seq
MIRT1226311	hsa-miR-4695-5p	CLIP-seq
MIRT1226365	hsa-miR-4700-5p	CLIP-seq
MIRT1226312	hsa-miR-4707-5p	CLIP-seq
MIRT1226366	hsa-miR-4725-3p	CLIP-seq
MIRT1226367	hsa-miR-4731-5p	CLIP-seq
MIRT1226317	hsa-miR-4747-5p	CLIP-seq
MIRT1226320	hsa-miR-4755-3p	CLIP-seq
MIRT1226368	hsa-miR-4760-3p	CLIP-seq
MIRT1226322	hsa-miR-4779	CLIP-seq
MIRT1226323	hsa-miR-4789-3p	CLIP-seq
MIRT1226324	hsa-miR-4789-5p	CLIP-seq
MIRT1226369	hsa-miR-512-3p	CLIP-seq
MIRT1226370	hsa-miR-520a-3p	CLIP-seq
MIRT1226371	hsa-miR-520b	CLIP-seq
MIRT1226372	hsa-miR-520c-3p	CLIP-seq
MIRT1226373	hsa-miR-520d-3p	CLIP-seq
MIRT1226374	hsa-miR-520e	CLIP-seq
MIRT1226375	hsa-miR-613	CLIP-seq
MIRT1226337	hsa-miR-922	CLIP-seq
MIRT1226272	hsa-miR-224	CLIP-seq
MIRT1226287	hsa-miR-377	CLIP-seq
MIRT1226323	hsa-miR-4789-3p	CLIP-seq
MIRT2066222	hsa-miR-1183	CLIP-seq
MIRT2066223	hsa-miR-1206	CLIP-seq
MIRT2066224	hsa-miR-1245b-5p	CLIP-seq
MIRT1226257	hsa-miR-1247	CLIP-seq
MIRT1226259	hsa-miR-1266	CLIP-seq
MIRT2066225	hsa-miR-128	CLIP-seq
MIRT2066226	hsa-miR-1285	CLIP-seq
MIRT1226341	hsa-miR-1324	CLIP-seq
MIRT2066227	hsa-miR-140-3p	CLIP-seq
MIRT2066228	hsa-miR-1470	CLIP-seq
MIRT1226342	hsa-miR-150	CLIP-seq
MIRT2066229	hsa-miR-1915	CLIP-seq
MIRT2066230	hsa-miR-196a	CLIP-seq
MIRT2066231	hsa-miR-196b	CLIP-seq
MIRT2066232	hsa-miR-1976	CLIP-seq
MIRT2066233	hsa-miR-198	CLIP-seq
MIRT1226272	hsa-miR-224	CLIP-seq
MIRT1226273	hsa-miR-2467-5p	CLIP-seq
MIRT2066234	hsa-miR-300	CLIP-seq
MIRT2066235	hsa-miR-3128	CLIP-seq
MIRT2066236	hsa-miR-3137	CLIP-seq
MIRT2066237	hsa-miR-3140-5p	CLIP-seq
MIRT2066238	hsa-miR-3142	CLIP-seq
MIRT2066239	hsa-miR-3144-5p	CLIP-seq
MIRT1226278	hsa-miR-3160-5p	CLIP-seq
MIRT2066240	hsa-miR-3175	CLIP-seq
MIRT2066241	hsa-miR-3183	CLIP-seq
MIRT2066242	hsa-miR-3187-5p	CLIP-seq
MIRT2066243	hsa-miR-331-5p	CLIP-seq
MIRT2066244	hsa-miR-339-5p	CLIP-seq
MIRT2066245	hsa-miR-3611	CLIP-seq
MIRT2066246	hsa-miR-3620	CLIP-seq
MIRT2066247	hsa-miR-3685	CLIP-seq
MIRT1226286	hsa-miR-3714	CLIP-seq
MIRT1226287	hsa-miR-377	CLIP-seq
MIRT2066248	hsa-miR-378g	CLIP-seq
MIRT2066249	hsa-miR-381	CLIP-seq
MIRT2066250	hsa-miR-384	CLIP-seq
MIRT2066251	hsa-miR-3910	CLIP-seq
MIRT1226356	hsa-miR-3919	CLIP-seq
MIRT2066252	hsa-miR-3927	CLIP-seq
MIRT1226288	hsa-miR-3944-5p	CLIP-seq
MIRT2066253	hsa-miR-4257	CLIP-seq
MIRT1226289	hsa-miR-4266	CLIP-seq
MIRT2066254	hsa-miR-4267	CLIP-seq
MIRT1226290	hsa-miR-4269	CLIP-seq
MIRT2066255	hsa-miR-4277	CLIP-seq
MIRT2066256	hsa-miR-4287	CLIP-seq
MIRT2066257	hsa-miR-4297	CLIP-seq
MIRT1226292	hsa-miR-4302	CLIP-seq
MIRT2066258	hsa-miR-433	CLIP-seq
MIRT2066259	hsa-miR-4421	CLIP-seq
MIRT1226293	hsa-miR-4436a	CLIP-seq
MIRT1226297	hsa-miR-4457	CLIP-seq
MIRT2066260	hsa-miR-4469	CLIP-seq
MIRT2066261	hsa-miR-4486	CLIP-seq
MIRT1226299	hsa-miR-4514	CLIP-seq
MIRT1226300	hsa-miR-4518	CLIP-seq
MIRT2066262	hsa-miR-4520a-3p	CLIP-seq
MIRT2066263	hsa-miR-4520b-3p	CLIP-seq
MIRT2066264	hsa-miR-4527	CLIP-seq
MIRT2066265	hsa-miR-4529-3p	CLIP-seq
MIRT1226303	hsa-miR-4635	CLIP-seq
MIRT1226304	hsa-miR-4645-5p	CLIP-seq
MIRT1226306	hsa-miR-4650-5p	CLIP-seq
MIRT1226307	hsa-miR-4660	CLIP-seq
MIRT2066266	hsa-miR-4666-3p	CLIP-seq
MIRT2066267	hsa-miR-4667-3p	CLIP-seq
MIRT1226362	hsa-miR-4672	CLIP-seq
MIRT1226308	hsa-miR-4673	CLIP-seq
MIRT2066268	hsa-miR-4678	CLIP-seq
MIRT2066269	hsa-miR-4683	CLIP-seq
MIRT2066270	hsa-miR-4685-3p	CLIP-seq
MIRT1226310	hsa-miR-4692	CLIP-seq
MIRT1226311	hsa-miR-4695-5p	CLIP-seq
MIRT1226312	hsa-miR-4707-5p	CLIP-seq
MIRT1226313	hsa-miR-4709-3p	CLIP-seq
MIRT2066271	hsa-miR-4716-5p	CLIP-seq
MIRT2066272	hsa-miR-4720-5p	CLIP-seq
MIRT2066273	hsa-miR-4723-3p	CLIP-seq
MIRT2066274	hsa-miR-4726-3p	CLIP-seq
MIRT2066275	hsa-miR-4742-3p	CLIP-seq
MIRT1226317	hsa-miR-4747-5p	CLIP-seq
MIRT1226320	hsa-miR-4755-3p	CLIP-seq
MIRT1226368	hsa-miR-4760-3p	CLIP-seq
MIRT2066276	hsa-miR-4762-3p	CLIP-seq
MIRT2066277	hsa-miR-4762-5p	CLIP-seq
MIRT2066278	hsa-miR-4766-5p	CLIP-seq
MIRT1226322	hsa-miR-4779	CLIP-seq
MIRT1226323	hsa-miR-4789-3p	CLIP-seq
MIRT2066279	hsa-miR-4799-3p	CLIP-seq
MIRT2066280	hsa-miR-485-5p	CLIP-seq
MIRT2066281	hsa-miR-488	CLIP-seq
MIRT2066282	hsa-miR-493	CLIP-seq
MIRT2066283	hsa-miR-513a-3p	CLIP-seq
MIRT2066284	hsa-miR-522	CLIP-seq
MIRT2066285	hsa-miR-548an	CLIP-seq
MIRT2066286	hsa-miR-579	CLIP-seq
MIRT2066287	hsa-miR-612	CLIP-seq
MIRT2066288	hsa-miR-621	CLIP-seq
MIRT2066289	hsa-miR-634	CLIP-seq
MIRT1226333	hsa-miR-648	CLIP-seq
MIRT2066290	hsa-miR-758	CLIP-seq
MIRT2066291	hsa-miR-759	CLIP-seq
MIRT2066292	hsa-miR-943	CLIP-seq
MIRT1226286	hsa-miR-3714	CLIP-seq
MIRT2066251	hsa-miR-3910	CLIP-seq
MIRT2066285	hsa-miR-548an	CLIP-seq
MIRT1226257	hsa-miR-1247	CLIP-seq
MIRT2066229	hsa-miR-1915	CLIP-seq
MIRT1226278	hsa-miR-3160-5p	CLIP-seq
MIRT1226286	hsa-miR-3714	CLIP-seq
MIRT1226312	hsa-miR-4707-5p	CLIP-seq
MIRT1226331	hsa-miR-548t	CLIP-seq
MIRT2066291	hsa-miR-759	CLIP-seq
MIRT1226278	hsa-miR-3160-5p	CLIP-seq
MIRT2456278	hsa-miR-337-5p	CLIP-seq
MIRT2456279	hsa-miR-4768-5p	CLIP-seq
MIRT2456280	hsa-miR-942	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
HIF1A	Unknown	16025159

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0003873	Function	6-phosphofructo-2-kinase activity	IBA
GO:0003873	Function	6-phosphofructo-2-kinase activity	IDA	10077634, 17499765
GO:0003873	Function	6-phosphofructo-2-kinase activity	IEA
GO:0003873	Function	6-phosphofructo-2-kinase activity	NAS	8830046
GO:0004331	Function	Fructose-2,6-bisphosphate 2-phosphatase activity	IBA
GO:0004331	Function	Fructose-2,6-bisphosphate 2-phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006000	Process	Fructose metabolic process	IEA
GO:0006003	Process	Fructose 2,6-bisphosphate metabolic process	IBA
GO:0006003	Process	Fructose 2,6-bisphosphate metabolic process	IDA	1749976
GO:0006003	Process	Fructose 2,6-bisphosphate metabolic process	IEA
GO:0006094	Process	Gluconeogenesis	NAS	15581487
GO:0006096	Process	Glycolytic process	IEA
GO:0006096	Process	Glycolytic process	NAS	15581487
GO:0006915	Process	Apoptotic process	IEA
GO:0010001	Process	Glial cell differentiation	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0043540	Component	6-phosphofructo-2-kinase/fructose-2,6-biphosphatase complex	IPI	1749976
GO:0046835	Process	Carbohydrate phosphorylation	IEA
GO:0061744	Process	Motor behavior	IEA

MIM	HGNC	e!Ensembl
605319	8874	ENSG00000170525

Q16875

Protein name

6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (6PF-2-K/Fru-2,6-P2ase 3) (PFK/FBPase 3) (6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme) (Renal carcinoma antigen NY-REN-56) (iPFK-2) [Includes: 6-phosphofructo-2-kinase (EC 2.7.1.105); Fructose-2

Protein function

Catalyzes both the synthesis and degradation of fructose 2,6-bisphosphate.

PDB

2AXN , 2DWO , 2DWP , 2I1V , 3QPU , 3QPV , 3QPW , 4D4J , 4D4K , 4D4L , 4D4M , 4MA4 , 5AJV , 5AJW , 5AJX , 5AJY , 5AJZ , 5AK0 , 6ETJ , 6HVH , 6HVI , 6HVJ , 6IBX , 6IBY , 6IBZ , 6IC0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01591	6PF2K	24 → 246	6-phosphofructo-2-kinase	Domain
PF00300	His_Phos_1	249 → 435	Histidine phosphatase superfamily (branch 1)	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLN
WIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQ
IAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNS
AEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLM
NIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQ
LKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTG
ESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKL
TPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFE
EHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH

Sequence length

520

Interactions

View interactions

	KEGG		Reactome
	Fructose and mannose metabolism Metabolic pathways HIF-1 signaling pathway AMPK signaling pathway		Regulation of glycolysis by fructose 2,6-bisphosphate metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATENT AUTOIMMUNE DIABETES IN ADULTS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SELECTIVE IGA DEFICIENCY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (119)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	26530697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29327288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	26530697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	31864394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24043759, 35886000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27777982	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	31466915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17805487, 19490427, 31369092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	30254083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	23333658		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27373212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	39969331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26093295, 26171876, 27613609, 28348059, 29335521, 29393396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24515104, 36973739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27079271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24568531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27373212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31126985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37253634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31406177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	38320734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31406177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34871464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	31511238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	39256343	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16115917, 31671668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26530697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24829520, 31671668, 32990355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36733385	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26718307, 28239846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	38320734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	36973739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30254083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30254083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29203581, 31720731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30867526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37986381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33420377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32282711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	30977208		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	30977208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17805487, 19490427, 21987444, 28834297, 31369092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28834297, 34234350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19490427, 21987444, 28834297, 31369092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	39969331	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	39969331	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	35094634, 36973739	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	36577299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	37047426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31213542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	31511238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	11744734, 16698023, 23840896	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15598882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30817168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34280322	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36405760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	27535281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	30254083	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28082200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28857200, 29559632, 30981500, 31071366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31126985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27983531	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	23333658		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	23333658		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	25320508, 26171876, 27613609, 28348059, 29335521, 29393396, 31413316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25320508, 31126985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31410981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17143338, 27983531, 31026442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27373212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10077634, 16115917, 23548149, 24295899, 24829520, 25320508, 26337471, 27079271, 27491040, 27866851, 28061878, 28173976, 28977989, 29113354, 29151977 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31671668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27613609		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16311927		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29440170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23333658		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	23333658		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma Malignant	Mesothelioma	Pubtator	35794237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	23333658		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth neoplasm	Pubtator	33762576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31153642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35371618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	39595988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29511345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29151977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35131382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10077634, 12384552, 15466858, 16115917, 17805487, 18202014, 25576833, 26681033, 27079271, 27373212, 27491040, 27866851, 28061878, 28875379, 28945981 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31754349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28875330, 31126985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18180783		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	20882379		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	35787188	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity, Morbid	Obesity	BEFREE	18180783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25672572, 26681033, 31678169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29866066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17143338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31410981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31410981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30817168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	34775492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	29620138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24043759, 27777982, 28239846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	31093495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31093495, 31167111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31209811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31053633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28061878, 30785217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27983531, 31026442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	17143338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27983531, 33390824, 35637411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35094634	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	39969331	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12384552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36990998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	27079271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	23333658		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26980488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PFKFB3 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3)