Gene Gene information from NCBI Gene database.
Entrez ID 5191
Gene name Peroxisomal biogenesis factor 7
Gene symbol PEX7
Synonyms (NCBI Gene)
PBD9BPTS2RRCDP1RD
Chromosome 6
Chromosome location 6q23.3
Summary This gene encodes the cytosolic receptor for the set of peroxisomal matrix enzymes targeted to the organelle by the peroxisome targeting signal 2 (PTS2). Defects in this gene cause peroxisome biogenesis disorders (PBDs), which are characterized by multipl
SNPs SNP information provided by dbSNP.
58
SNP ID Visualize variation Clinical significance Consequence
rs1805137 T>A Pathogenic-likely-pathogenic, pathogenic Stop gained, coding sequence variant, stop lost, terminator codon variant
rs61753233 A>C Pathogenic Missense variant, coding sequence variant, genic upstream transcript variant, upstream transcript variant
rs61753236 C>T Likely-pathogenic, uncertain-significance Missense variant, coding sequence variant, genic upstream transcript variant, upstream transcript variant
rs61753237 A>C Likely-pathogenic Missense variant, coding sequence variant, genic upstream transcript variant, upstream transcript variant
rs61753238 C>A,G,T Pathogenic Genic upstream transcript variant, upstream transcript variant, stop gained, coding sequence variant, synonymous variant
miRNA miRNA information provided by mirtarbase database.
58
miRTarBase ID miRNA Experiments Reference
MIRT543256 hsa-miR-548n PAR-CLIP 21572407
MIRT543255 hsa-miR-548a-5p PAR-CLIP 21572407
MIRT543254 hsa-miR-548ab PAR-CLIP 21572407
MIRT543253 hsa-miR-548ad-5p PAR-CLIP 21572407
MIRT543252 hsa-miR-548ae-5p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0001764 Process Neuron migration IEA
GO:0001958 Process Endochondral ossification IEA
GO:0005053 Function Peroxisome matrix targeting signal-2 binding IBA
GO:0005053 Function Peroxisome matrix targeting signal-2 binding IDA 9090381, 9090383, 11931631, 22057399, 25538232
GO:0005053 Function Peroxisome matrix targeting signal-2 binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601757 8860 ENSG00000112357
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00628
Protein name Peroxisomal targeting signal 2 receptor (PTS2 receptor) (Peroxin-7)
Protein function Receptor required for the peroxisomal import of proteins containing a C-terminal PTS2-type peroxisomal targeting signal (PubMed:11931631, PubMed:22057399, PubMed:25538232, PubMed:9090381). Specifically binds to cargo proteins containing a PTS2 p
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 58 96 WD domain, G-beta repeat Repeat
PF00400 WD40 101 141 WD domain, G-beta repeat Repeat
PF00400 WD40 145 184 WD domain, G-beta repeat Repeat
PF00400 WD40 232 271 WD domain, G-beta repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Ubiquitous (PubMed:9090381). Highest expression in pancreas, skeletal muscle and heart (PubMed:9090381). {ECO:0000269|PubMed:9090381}.
Sequence
MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRL
FRSFDWNDGLFDVTWSENNEHVLITCSGDGSLQLWD
TAKAAGPLQVYKEHAQEVYSVDWS
QTRGEQLVVSGSWDQTVKLWD
PTVGKSLCTFRGHESIIYSTIWSPHIPGCFASASGDQTL
RIWD
VKAAGVRIVIPAHQAEILSCDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELLG
HTYAIRRVKFSPFHASVLASCSYDFTVRFWN
FSKPDSLLETVEHHTEFTCGLDFSLQSPT
QVADCSWDETIKIYDPACLTIPA
Sequence length 323
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Peroxisome   Peroxisomal protein import
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
28
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Abnormality of metabolism/homeostasis Likely pathogenic rs2115131765 RCV001814330
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Connective tissue disorder Likely pathogenic; Pathogenic rs763514968 RCV002278634
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intermediate form of PEX7 related rhizomelic chondrodysplasia punctata Likely pathogenic rs2115216571 RCV001420996
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Melanoma Likely pathogenic rs780751870 RCV005925481
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ADULT REFSUM DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHONDRODYSPLASIA PUNCTATA Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHONDRODYSPLASIA PUNCTATA, RHIZOMELIC CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISEASES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acquired Kyphoscoliosis Acquired Kyphoscoliosis HPO_DG
★☆☆☆☆
Found in Text Mining only
Adrenoleukodystrophy, Neonatal Adrenoleukodystrophy BEFREE 10527683
★☆☆☆☆
Found in Text Mining only
Alopecia Alopecia HPO_DG
★☆☆☆☆
Found in Text Mining only
Astigmatism Astigmatism Pubtator 30747064 Associate
★☆☆☆☆
Found in Text Mining only
Ataxia Ataxia Pubtator 12522768 Associate
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorders Autism Spectrum Disorder BEFREE 22378669, 23352163
★☆☆☆☆
Found in Text Mining only
Blepharoptosis Ptosis HPO_DG
★☆☆☆☆
Found in Text Mining only
Cardiomyopathies Cardiomyopathy HPO_DG
★☆☆☆☆
Found in Text Mining only
Cataract Cataract HPO_DG
★☆☆☆☆
Found in Text Mining only
Cerebral cortical atrophy Cerebral cortical atrophy HPO_DG
★☆☆☆☆
Found in Text Mining only