Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51806
Gene name	Calmodulin like 5
Gene symbol	CALML5
Synonyms (NCBI Gene)	CLSP
Chromosome	10
Chromosome location	10p15.1
Summary	This gene encodes a novel calcium binding protein expressed in the epidermis and related to the calmodulin family of calcium binding proteins. Functional studies with recombinant protein demonstrate it does bind calcium and undergoes a conformational chan

Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018952	hsa-miR-335-5p	Microarray	18185580
MIRT021412	hsa-miR-9-5p	Microarray	17612493
MIRT859594	hsa-miR-24	CLIP-seq
MIRT859595	hsa-miR-4716-3p	CLIP-seq
MIRT859594	hsa-miR-24	CLIP-seq
MIRT2192843	hsa-miR-15a	CLIP-seq
MIRT2192844	hsa-miR-15b	CLIP-seq
MIRT2192845	hsa-miR-16	CLIP-seq
MIRT2192846	hsa-miR-195	CLIP-seq
MIRT2192847	hsa-miR-424	CLIP-seq
MIRT2192848	hsa-miR-4767	CLIP-seq
MIRT2192849	hsa-miR-497	CLIP-seq
MIRT2192850	hsa-miR-503	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	10777582
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0007165	Process	Signal transduction	TAS	10777582
GO:0008544	Process	Epidermis development	TAS	10777582
GO:0030234	Function	Enzyme regulator activity	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
605183	18180	ENSG00000178372

Q9NZT1

Protein name

Calmodulin-like protein 5 (Calmodulin-like skin protein)

Protein function

Binds calcium. May be involved in terminal differentiation of keratinocytes.

PDB

2B1U

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13499	EF-hand_7	10 → 74	EF-hand domain pair	Domain
PF00036	EF-hand_1	12 → 40	EF hand	Domain
PF13499	EF-hand_7	80 → 144	EF-hand domain pair	Domain
PF13833	EF-hand_8	95 → 146	EF-hand domain pair	Domain

Tissue specificity

TISSUE SPECIFICITY: Particularly abundant in the epidermis where its expression is directly related to keratinocyte differentiation. Very low expression in lung.

Sequence

MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDG
DGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELD
AMIREADVDQDGRVNYEEFARMLAQE

Sequence length

146

Interactions

View interactions

	KEGG		Reactome
	Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway cGMP-PKG signaling pathway cAMP signaling pathway Phosphatidylinositol signaling system Oocyte meiosis Cellular senescence Adrenergic signaling in cardiomyocytes Vascular smooth muscle contraction Apelin signaling pathway C-type lectin receptor signaling pathway Circadian entrainment Long-term potentiation Neurotrophin signaling pathway Dopaminergic synapse Olfactory transduction Phototransduction Inflammatory mediator regulation of TRP channels Insulin signaling pathway GnRH signaling pathway Estrogen signaling pathway Melanogenesis Oxytocin signaling pathway Glucagon signaling pathway Renin secretion Aldosterone synthesis and secretion Salivary secretion Gastric acid secretion Alzheimer disease Parkinson disease Pathways of neurodegeneration - multiple diseases Amphetamine addiction Alcoholism Pertussis Tuberculosis Human cytomegalovirus infection Kaposi sarcoma-associated herpesvirus infection Human immunodeficiency virus 1 infection Pathways in cancer Glioma Lipid and atherosclerosis Fluid shear stress and atherosclerosis		Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autoimmune Diseases	Autoimmune disease	Pubtator	34539672	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24146193, 36602226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24146193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36924358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conjunctival Diseases	Conjunctival disease	Pubtator	28918083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	24205894	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	16689864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	28918083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	34539672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	33823876, 38013352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	32415241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16689864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	28122643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38025757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	39456780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37400149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CALML5 (calmodulin like 5)