Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51773
Gene name	Remodeling and spacing factor 1
Gene symbol	RSF1
Synonyms (NCBI Gene)	HBXAPRSF-1XAP8p325
Chromosome	11
Chromosome location	11q14.1
Summary	This gene encodes a nuclear protein that interacts with hepatitis B virus X protein (HBX) and facilitates transcription of hepatitis B virus genes by the HBX transcription activator, suggesting a role for this interaction in the virus life cycle. This pro

242

Show/Hide all (242)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016606	hsa-miR-193b-3p	Microarray	20304954
MIRT020975	hsa-miR-155-5p	Proteomics	20209161
MIRT024034	hsa-miR-1-3p	Proteomics	18668040
MIRT031001	hsa-miR-21-5p	Microarray	18591254
MIRT654093	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT654092	hsa-miR-4267	HITS-CLIP	23824327
MIRT654091	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT654090	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT654089	hsa-miR-4482-3p	HITS-CLIP	23824327
MIRT622389	hsa-miR-618	HITS-CLIP	23824327
MIRT612534	hsa-miR-8485	HITS-CLIP	23824327
MIRT638312	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622388	hsa-miR-4643	HITS-CLIP	23824327
MIRT622387	hsa-miR-6512-5p	HITS-CLIP	23824327
MIRT622386	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT622385	hsa-miR-466	HITS-CLIP	23824327
MIRT622384	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT622389	hsa-miR-618	HITS-CLIP	23824327
MIRT622388	hsa-miR-4643	HITS-CLIP	23824327
MIRT622387	hsa-miR-6512-5p	HITS-CLIP	23824327
MIRT622386	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT622385	hsa-miR-466	HITS-CLIP	23824327
MIRT622384	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT612540	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT612539	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT612538	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT612537	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT612536	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT612535	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT612534	hsa-miR-8485	HITS-CLIP	23824327
MIRT447016	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT447011	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT447009	hsa-miR-6830-5p	PAR-CLIP	22100165
MIRT447007	hsa-miR-3171	PAR-CLIP	22100165
MIRT447006	hsa-miR-561-5p	PAR-CLIP	22100165
MIRT447016	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT447015	hsa-miR-181a-5p	PAR-CLIP	22100165
MIRT447014	hsa-miR-181b-5p	PAR-CLIP	22100165
MIRT447013	hsa-miR-181c-5p	PAR-CLIP	22100165
MIRT447012	hsa-miR-181d-5p	PAR-CLIP	22100165
MIRT447010	hsa-miR-4262	PAR-CLIP	22100165
MIRT447011	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT447009	hsa-miR-6830-5p	PAR-CLIP	22100165
MIRT447008	hsa-miR-4635	PAR-CLIP	22100165
MIRT447007	hsa-miR-3171	PAR-CLIP	22100165
MIRT447006	hsa-miR-561-5p	PAR-CLIP	22100165
MIRT447005	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT447004	hsa-miR-493-5p	PAR-CLIP	22100165
MIRT439722	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439722	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT654093	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT654092	hsa-miR-4267	HITS-CLIP	23824327
MIRT654091	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT654090	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT654089	hsa-miR-4482-3p	HITS-CLIP	23824327
MIRT622389	hsa-miR-618	HITS-CLIP	23824327
MIRT612534	hsa-miR-8485	HITS-CLIP	23824327
MIRT638312	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT622388	hsa-miR-4643	HITS-CLIP	23824327
MIRT622387	hsa-miR-6512-5p	HITS-CLIP	23824327
MIRT622386	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT622385	hsa-miR-466	HITS-CLIP	23824327
MIRT622384	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT622389	hsa-miR-618	HITS-CLIP	23824327
MIRT622388	hsa-miR-4643	HITS-CLIP	23824327
MIRT622387	hsa-miR-6512-5p	HITS-CLIP	23824327
MIRT622386	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT622385	hsa-miR-466	HITS-CLIP	23824327
MIRT622384	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT612540	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT612539	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT612538	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT612537	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT612536	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT612535	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT612534	hsa-miR-8485	HITS-CLIP	23824327
MIRT447016	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT447011	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT447009	hsa-miR-6830-5p	PAR-CLIP	22100165
MIRT447007	hsa-miR-3171	PAR-CLIP	22100165
MIRT447006	hsa-miR-561-5p	PAR-CLIP	22100165
MIRT447016	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT447015	hsa-miR-181a-5p	PAR-CLIP	22100165
MIRT447014	hsa-miR-181b-5p	PAR-CLIP	22100165
MIRT447013	hsa-miR-181c-5p	PAR-CLIP	22100165
MIRT447012	hsa-miR-181d-5p	PAR-CLIP	22100165
MIRT447010	hsa-miR-4262	PAR-CLIP	22100165
MIRT447011	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT447009	hsa-miR-6830-5p	PAR-CLIP	22100165
MIRT447008	hsa-miR-4635	PAR-CLIP	22100165
MIRT447007	hsa-miR-3171	PAR-CLIP	22100165
MIRT447006	hsa-miR-561-5p	PAR-CLIP	22100165
MIRT447005	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT447004	hsa-miR-493-5p	PAR-CLIP	22100165
MIRT1321169	hsa-miR-101	CLIP-seq
MIRT1321170	hsa-miR-1236	CLIP-seq
MIRT1321171	hsa-miR-1272	CLIP-seq
MIRT1321172	hsa-miR-1273g	CLIP-seq
MIRT1321173	hsa-miR-1283	CLIP-seq
MIRT1321174	hsa-miR-132	CLIP-seq
MIRT1321175	hsa-miR-1322	CLIP-seq
MIRT1321176	hsa-miR-142-5p	CLIP-seq
MIRT1321177	hsa-miR-194	CLIP-seq
MIRT1321178	hsa-miR-212	CLIP-seq
MIRT1321179	hsa-miR-300	CLIP-seq
MIRT1321180	hsa-miR-30a	CLIP-seq
MIRT1321181	hsa-miR-30b	CLIP-seq
MIRT1321182	hsa-miR-30c	CLIP-seq
MIRT1321183	hsa-miR-30d	CLIP-seq
MIRT1321184	hsa-miR-30e	CLIP-seq
MIRT1321185	hsa-miR-3148	CLIP-seq
MIRT1321186	hsa-miR-323b-3p	CLIP-seq
MIRT1321187	hsa-miR-340	CLIP-seq
MIRT1321188	hsa-miR-3613-3p	CLIP-seq
MIRT1321189	hsa-miR-3619-3p	CLIP-seq
MIRT1321190	hsa-miR-3664-3p	CLIP-seq
MIRT1321191	hsa-miR-3670	CLIP-seq
MIRT1321192	hsa-miR-369-3p	CLIP-seq
MIRT1321193	hsa-miR-371-5p	CLIP-seq
MIRT1321194	hsa-miR-371b-5p	CLIP-seq
MIRT1321195	hsa-miR-374a	CLIP-seq
MIRT1321196	hsa-miR-374b	CLIP-seq
MIRT1321197	hsa-miR-381	CLIP-seq
MIRT1321198	hsa-miR-3924	CLIP-seq
MIRT1321199	hsa-miR-4433	CLIP-seq
MIRT1321200	hsa-miR-4459	CLIP-seq
MIRT1321201	hsa-miR-4477a	CLIP-seq
MIRT1321202	hsa-miR-4666-3p	CLIP-seq
MIRT1321203	hsa-miR-4719	CLIP-seq
MIRT1321204	hsa-miR-4768-3p	CLIP-seq
MIRT1321205	hsa-miR-4778-3p	CLIP-seq
MIRT1321206	hsa-miR-4795-3p	CLIP-seq
MIRT1321207	hsa-miR-490-3p	CLIP-seq
MIRT1321208	hsa-miR-5096	CLIP-seq
MIRT1321209	hsa-miR-513b	CLIP-seq
MIRT1321210	hsa-miR-513c	CLIP-seq
MIRT1321211	hsa-miR-514b-5p	CLIP-seq
MIRT1321212	hsa-miR-515-5p	CLIP-seq
MIRT1321213	hsa-miR-548g	CLIP-seq
MIRT1321214	hsa-miR-579	CLIP-seq
MIRT1321215	hsa-miR-587	CLIP-seq
MIRT1321216	hsa-miR-591	CLIP-seq
MIRT1321217	hsa-miR-593	CLIP-seq
MIRT1321218	hsa-miR-595	CLIP-seq
MIRT1321219	hsa-miR-619	CLIP-seq
MIRT1321220	hsa-miR-873	CLIP-seq
MIRT1321221	hsa-miR-875-3p	CLIP-seq
MIRT2095326	hsa-miR-138	CLIP-seq
MIRT2095327	hsa-miR-1538	CLIP-seq
MIRT2095328	hsa-miR-203	CLIP-seq
MIRT2095329	hsa-miR-27a	CLIP-seq
MIRT2095330	hsa-miR-27b	CLIP-seq
MIRT2095331	hsa-miR-302a	CLIP-seq
MIRT2095332	hsa-miR-302b	CLIP-seq
MIRT2095333	hsa-miR-302c	CLIP-seq
MIRT2095334	hsa-miR-302d	CLIP-seq
MIRT2095335	hsa-miR-302e	CLIP-seq
MIRT1321185	hsa-miR-3148	CLIP-seq
MIRT2095336	hsa-miR-3650	CLIP-seq
MIRT2095337	hsa-miR-3688-3p	CLIP-seq
MIRT2095338	hsa-miR-372	CLIP-seq
MIRT2095339	hsa-miR-373	CLIP-seq
MIRT1321195	hsa-miR-374a	CLIP-seq
MIRT1321196	hsa-miR-374b	CLIP-seq
MIRT2095340	hsa-miR-4694-3p	CLIP-seq
MIRT2095341	hsa-miR-4745-3p	CLIP-seq
MIRT2095342	hsa-miR-513a-5p	CLIP-seq
MIRT2095343	hsa-miR-520a-3p	CLIP-seq
MIRT2095344	hsa-miR-520b	CLIP-seq
MIRT2095345	hsa-miR-520c-3p	CLIP-seq
MIRT2095346	hsa-miR-520d-3p	CLIP-seq
MIRT2095347	hsa-miR-520e	CLIP-seq
MIRT2095348	hsa-miR-520f	CLIP-seq
MIRT2095349	hsa-miR-548u	CLIP-seq
MIRT2095350	hsa-miR-582-3p	CLIP-seq
MIRT2095351	hsa-miR-586	CLIP-seq
MIRT2095352	hsa-miR-653	CLIP-seq
MIRT2319724	hsa-miR-1208	CLIP-seq
MIRT1321170	hsa-miR-1236	CLIP-seq
MIRT1321172	hsa-miR-1273g	CLIP-seq
MIRT2095326	hsa-miR-138	CLIP-seq
MIRT1321176	hsa-miR-142-5p	CLIP-seq
MIRT2095327	hsa-miR-1538	CLIP-seq
MIRT2095328	hsa-miR-203	CLIP-seq
MIRT2095329	hsa-miR-27a	CLIP-seq
MIRT2095330	hsa-miR-27b	CLIP-seq
MIRT1321179	hsa-miR-300	CLIP-seq
MIRT1321187	hsa-miR-340	CLIP-seq
MIRT1321188	hsa-miR-3613-3p	CLIP-seq
MIRT2095336	hsa-miR-3650	CLIP-seq
MIRT2319725	hsa-miR-3669	CLIP-seq
MIRT1321197	hsa-miR-381	CLIP-seq
MIRT2319726	hsa-miR-4420	CLIP-seq
MIRT1321201	hsa-miR-4477a	CLIP-seq
MIRT1321202	hsa-miR-4666-3p	CLIP-seq
MIRT2095341	hsa-miR-4745-3p	CLIP-seq
MIRT1321205	hsa-miR-4778-3p	CLIP-seq
MIRT2095342	hsa-miR-513a-5p	CLIP-seq
MIRT2095349	hsa-miR-548u	CLIP-seq
MIRT2095350	hsa-miR-582-3p	CLIP-seq
MIRT2095351	hsa-miR-586	CLIP-seq
MIRT1321217	hsa-miR-593	CLIP-seq
MIRT1321218	hsa-miR-595	CLIP-seq
MIRT2095352	hsa-miR-653	CLIP-seq
MIRT2458653	hsa-miR-142-3p	CLIP-seq
MIRT2458654	hsa-miR-3137	CLIP-seq
MIRT2458655	hsa-miR-3681	CLIP-seq
MIRT2458656	hsa-miR-3686	CLIP-seq
MIRT2458657	hsa-miR-4653-3p	CLIP-seq
MIRT2458658	hsa-miR-4778-5p	CLIP-seq
MIRT2458659	hsa-miR-548n	CLIP-seq
MIRT2458660	hsa-miR-548t	CLIP-seq
MIRT1321169	hsa-miR-101	CLIP-seq
MIRT2615507	hsa-miR-1231	CLIP-seq
MIRT1321174	hsa-miR-132	CLIP-seq
MIRT1321177	hsa-miR-194	CLIP-seq
MIRT1321178	hsa-miR-212	CLIP-seq
MIRT2615508	hsa-miR-3545-3p	CLIP-seq
MIRT2615509	hsa-miR-3607-3p	CLIP-seq
MIRT2458656	hsa-miR-3686	CLIP-seq
MIRT2615510	hsa-miR-4288	CLIP-seq
MIRT2615511	hsa-miR-4659a-5p	CLIP-seq
MIRT2615512	hsa-miR-4659b-5p	CLIP-seq
MIRT2615513	hsa-miR-499a-5p	CLIP-seq
MIRT2615514	hsa-miR-632	CLIP-seq
MIRT1321169	hsa-miR-101	CLIP-seq
MIRT2615507	hsa-miR-1231	CLIP-seq
MIRT1321172	hsa-miR-1273g	CLIP-seq
MIRT1321174	hsa-miR-132	CLIP-seq
MIRT1321177	hsa-miR-194	CLIP-seq
MIRT1321178	hsa-miR-212	CLIP-seq
MIRT2615508	hsa-miR-3545-3p	CLIP-seq
MIRT2615509	hsa-miR-3607-3p	CLIP-seq
MIRT2458656	hsa-miR-3686	CLIP-seq
MIRT2615510	hsa-miR-4288	CLIP-seq
MIRT1321201	hsa-miR-4477a	CLIP-seq
MIRT2615511	hsa-miR-4659a-5p	CLIP-seq
MIRT2615512	hsa-miR-4659b-5p	CLIP-seq
MIRT2615513	hsa-miR-499a-5p	CLIP-seq
MIRT1321212	hsa-miR-515-5p	CLIP-seq
MIRT1321218	hsa-miR-595	CLIP-seq
MIRT2615514	hsa-miR-632	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
AIP	Repression	21984905

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IEA
GO:0005515	Function	Protein binding	IPI	12972596, 29721183, 31694235, 32867128, 35271311
GO:0005634	Component	Nucleus	IDA	11788598, 12972596
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006325	Process	Chromatin organization	IDA	11691835
GO:0006325	Process	Chromatin organization	IEA
GO:0006334	Process	Nucleosome assembly	EXP	11691835
GO:0006334	Process	Nucleosome assembly	IDA	12972596
GO:0006338	Process	Chromatin remodeling	IDA	9836642
GO:0006352	Process	DNA-templated transcription initiation	IDA	9836642
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	12972596
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016887	Function	ATP hydrolysis activity	IDA	12972596
GO:0031213	Component	RSF complex	IBA
GO:0031213	Component	RSF complex	IEA
GO:0031213	Component	RSF complex	IPI	9836642, 12972596
GO:0042393	Function	Histone binding	IBA
GO:0042393	Function	Histone binding	IDA	12972596
GO:0043392	Process	Negative regulation of DNA binding	IDA	12972596
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	11944984
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	11788598
GO:0046872	Function	Metal ion binding	IEA
GO:0050434	Process	Positive regulation of viral transcription	IDA	11788598
GO:0140751	Function	Histone octamer slider activity	IDA	9836642

MIM	HGNC	e!Ensembl
608522	18118	ENSG00000048649

Q96T23

Protein name

Remodeling and spacing factor 1 (Rsf-1) (HBV pX-associated protein 8) (Hepatitis B virus X-associated protein) (p325 subunit of RSF chromatin-remodeling complex)

Protein function

Regulatory subunit of the ATP-dependent RSF-1 and RSF-5 ISWI chromatin-remodeling complexes, which form ordered nucleosome arrays on chromatin and facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, an

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15612	WHIM1	96 → 142	WSTF, HB1, Itc1p, MBD9 motif 1	Family
PF00628	PHD	893 → 941	PHD-finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Highly expressed in the heart, skeletal muscle, kidney and placenta (PubMed:12972596). Expressed at low levels in the brain and colon (PubMed:12972596). {ECO:0000269|PubMed:12972596}.

Sequence

MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGN
GEVPKELVELHLKLMRKIGKSVTADRWEKYLIKICQEFNSTWAWEMEKKGYLEMSVECKL
ALLKYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQ
DDQDGSSWKCIVRNRNELAETLALLKAQIDPVLLKNSSQQDNSSRESPSLEDEETKKEEE
TPKQEEQKESEKMKSEEQPMDLENRSTANVLEETTVKKEKEDEKELVKLPVIVKLEKPLP
ENEEKKIIKEESDSFKENVKPIKVEVKECRADPKDTKSSMEKPVAQEPERIEFGGNIKSS
HEITEKSTEETEKLKNDQQAKIPLKKREIKLSDDFDSPVKGPLCKSVTPTKEFLKDEIKQ
EEETCKRISTITALGHEGKQLVNGEVSDERVAPNFKTEPIETKFYETKEESYSPSKDRNI
ITEGNGTESLNSVITSMKTGELEKETAPLRKDADSSISVLEIHSQKAQIEEPDPPEMETS
LDSSEMAKDLSSKTALSSTESCTMKGEEKSPKTKKDKRPPILECLEKLEKSKKTFLDKDA
QRLSPIPEEVPKSTLESEKPGSPEAAETSPPSNIIDHCEKLASEKEVVECQSTSTVGGQS
VKKVDLETLKEDSEFTKVEMDNLDNAQTSGIEEPSETKGSMQKSKFKYKLVPEEETTASE
NTEITSERQKEGIKLTIRISSRKKKPDSPPKVLEPENKQEKTEKEEEKTNVGRTLRRSPR
ISRPTAKVAEIRDQKADKKRGEGEDEVEEESTALQKTDKKEILKKSEKDTNSKVSKVKPK
GKVRWTGSRTRGRWKYSSNDESEGSGSEKSSAASEEEEEKESEEAILADDDEPCKKCGLP
NHPELILLCDSCDSGYHTACLRPPLMIIPDGEWFCPPCQHKLLCEKLEEQLQDLDVALKK
KERAERRKERLVYVGISIENIIPPQEPDFSEDQEEKKKDSKKSKANLLERRSTRTRKCIS
YRFDEFDEAIDEAIEDDIKEADGGGVGRGKDISTITGHRGKDISTILDEERKENKRPQRA
AAARRKKRRRLNDLDSDSNLDEEESEDEFKISDGSQDEFVVSDENPDESEEDPPSNDDSD
TDFCSRRLRRHPSRPMRQSRRLRRKTPKKKYSDDDEEEESEENSRDSESDFSDDFSDDFV
ETRRRRSRRNQKRQINYKEDSESDGSQKSLRRGKEIRRVHKRRLSSSESEESYLSKNSED
DELAKESKRSVRKRGRSTDEYSEADEEEEEEEGKPSRKRLHRIETDEEESCDNAHGDANQ
PARDSQPRVLPSEQESTKKPYRIESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAI
ENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQ
L

Sequence length

1441

Interactions

View interactions

	KEGG		Reactome
	ATP-dependent chromatin remodeling		Deposition of new CENPA-containing nucleosomes at the centromere

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (53)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Atherosclerosis	Atherosclerosis	Pubtator	33757583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31485613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16938522, 30214561		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	18289639	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24367492, 25337201, 33413557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23974106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16938522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24798976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	20228782	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	25337201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22387541, 23456648, 28289901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21131837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16172393, 16938522, 18314909, 19190325, 20226169, 23378270, 24566868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22528946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22528946	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29467902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26666816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	23424626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11788598, 24798976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18289639	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21131837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22528946	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16938522, 24367492, 30214561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22387541, 23456648, 28289901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16172393, 16938522, 18314909, 19190325, 20226169, 23378270, 24566868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31687881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20923775, 21131837, 23378270, 23456648, 24566868, 28261335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22528946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24367492		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31485613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31485613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	16938522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28261335, 29258089, 29565706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	29565706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16844205, 16938522, 20923775, 21131837, 21514451, 22685262, 23378270, 23456648, 24798976, 26666816, 29258089, 29467902, 31687881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22387541, 28289901, 29258089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28843909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	23378270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	21131837		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16172393, 16938522, 18314909, 19190325, 20226169, 24566868		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16172393, 18314909, 19190325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16172393, 18289639, 19190325, 20923775, 21131837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18837990	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	16938522, 20923775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31687881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24584698	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29467902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21514451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21514451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22977663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	22685262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29048677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	22685262		★★★★★ ★☆☆☆☆ Found in Text Mining only

RSF1 (remodeling and spacing factor 1)