TMEM8B (transmembrane protein 8B)

Gene

• Entrez ID: 51754
• Gene name: Transmembrane protein 8B
• Gene symbol: TMEM8B
• Synonyms (NCBI Gene): C9orf127, FP588, LINC00950, NAG-5, NAG5, NGX6, NGX6a
• Chromosome: 9
• Chromosome location: 9p13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018101	hsa-miR-335-5p	Microarray	18185580
MIRT043252	hsa-miR-324-5p	CLASH	23622248
MIRT1439584	hsa-miR-153	CLIP-seq
MIRT1439585	hsa-miR-1909	CLIP-seq
MIRT1439586	hsa-miR-3664-3p	CLIP-seq
MIRT1439587	hsa-miR-3664-5p	CLIP-seq
MIRT1439588	hsa-miR-4522	CLIP-seq
MIRT1439589	hsa-miR-4645-5p	CLIP-seq
MIRT1439590	hsa-miR-4652-5p	CLIP-seq
MIRT1439591	hsa-miR-4673	CLIP-seq
MIRT1439592	hsa-miR-4716-3p	CLIP-seq
MIRT1439593	hsa-miR-4763-5p	CLIP-seq
MIRT1439594	hsa-miR-508-5p	CLIP-seq
MIRT1439595	hsa-miR-550a	CLIP-seq
MIRT2131628	hsa-miR-4293	CLIP-seq
MIRT2131629	hsa-miR-4649-3p	CLIP-seq
MIRT2131630	hsa-miR-4663	CLIP-seq
MIRT2131631	hsa-miR-544b	CLIP-seq
MIRT2131632	hsa-miR-628-5p	CLIP-seq
MIRT2131633	hsa-miR-671-5p	CLIP-seq
MIRT2352956	hsa-miR-3148	CLIP-seq
MIRT2352957	hsa-miR-3910	CLIP-seq
MIRT2352958	hsa-miR-4668-5p	CLIP-seq
MIRT1439592	hsa-miR-4716-3p	CLIP-seq
MIRT2352959	hsa-miR-548an	CLIP-seq
MIRT2352960	hsa-miR-625	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15498789
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	IDA	15498789
GO:0005886	Component	Plasma membrane	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IMP	15498789
GO:0007346	Process	Regulation of mitotic cell cycle	TAS	15498789
GO:0009986	Component	Cell surface	IDA	15498789
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 616888
• HGNC: 21427
• e!Ensembl: ENSG00000137103

Protein

• UniProt ID: A6NDV4
• Protein name: Transmembrane protein 8B (Nasopharyngeal carcinoma-associated gene 6 protein) (Protein NAG-5) (Protein NGX6)
• Protein function: May function as a regulator of the EGFR pathway. Probable tumor suppressor which may function in cell growth, proliferation and adhesion. {ECO:0000269|PubMed:15498789, ECO:0000269|PubMed:15723283, ECO:0000269|PubMed:17270023, ECO:0000269|PubMed:
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12036	DUF3522	231 → 415	Protein of unknown function (DUF3522)	Family

• Sequence:

  MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPS
  VALPPERPAVFAMRLLPVLDSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAV
  TCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMR
  TFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLC
  LSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMDYDVLQFCDFL
  GSLMSVWVTVIAMARLQPVVKQVLYLLGAMLLSMALQLDRHGLWNLLGPSLFALGILATA
  WTVRSVRRRHCYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGS
  VGFLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS

• Sequence length: 472

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPOTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	23053953, 23588848		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19499154	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	26880583		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	26261522	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29886078		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19353243, 20423473, 20705583, 20859756, 22647848		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12918109, 19499154, 20423473, 25029911, 26880583		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12918109		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12918109	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19499154, 20423473, 20705583, 22647848, 25029911	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29243779		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	29243779	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26261522	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23053953, 23588848		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29886078		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24338274		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20423473		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19353243, 20423473, 20705583, 20859756, 22647848		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12474055, 15723283, 17270023, 17641538, 19499154, 19755717, 20423473, 20705583, 20859756, 22647848, 23053953, 23588848, 24338274, 25029911, 26880583, 29243779, 29886078		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	17270023, 29243779	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15723283, 20423473, 20859756, 22647848, 23053953, 23588848, 26880583		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24338274		★☆☆☆☆ Found in Text Mining only