Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5175
Gene name	Platelet and endothelial cell adhesion molecule 1
Gene symbol	PECAM1
Synonyms (NCBI Gene)	CD31CD31/EndoCAMGPIIA'PECA1PECAM-1endoCAM
Chromosome	17
Chromosome location	17q23.3
Summary	The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin super

227

Show/Hide all (227)

miRTarBase ID	miRNA	Experiments
MIRT1224533	hsa-miR-1227	CLIP-seq
MIRT1224534	hsa-miR-1271	CLIP-seq
MIRT1224535	hsa-miR-1285	CLIP-seq
MIRT1224536	hsa-miR-182	CLIP-seq
MIRT1224537	hsa-miR-1972	CLIP-seq
MIRT1224538	hsa-miR-2278	CLIP-seq
MIRT1224539	hsa-miR-24	CLIP-seq
MIRT1224540	hsa-miR-2467-3p	CLIP-seq
MIRT1224541	hsa-miR-3065-5p	CLIP-seq
MIRT1224542	hsa-miR-31	CLIP-seq
MIRT1224543	hsa-miR-3168	CLIP-seq
MIRT1224544	hsa-miR-3187-5p	CLIP-seq
MIRT1224545	hsa-miR-3192	CLIP-seq
MIRT1224546	hsa-miR-3195	CLIP-seq
MIRT1224547	hsa-miR-339-5p	CLIP-seq
MIRT1224548	hsa-miR-3622b-5p	CLIP-seq
MIRT1224549	hsa-miR-3688-5p	CLIP-seq
MIRT1224550	hsa-miR-3929	CLIP-seq
MIRT1224551	hsa-miR-3945	CLIP-seq
MIRT1224552	hsa-miR-4252	CLIP-seq
MIRT1224553	hsa-miR-4253	CLIP-seq
MIRT1224554	hsa-miR-4257	CLIP-seq
MIRT1224555	hsa-miR-4284	CLIP-seq
MIRT1224556	hsa-miR-4314	CLIP-seq
MIRT1224557	hsa-miR-4419b	CLIP-seq
MIRT1224558	hsa-miR-4421	CLIP-seq
MIRT1224559	hsa-miR-4433	CLIP-seq
MIRT1224560	hsa-miR-4459	CLIP-seq
MIRT1224561	hsa-miR-4468	CLIP-seq
MIRT1224562	hsa-miR-4475	CLIP-seq
MIRT1224563	hsa-miR-4477a	CLIP-seq
MIRT1224564	hsa-miR-4478	CLIP-seq
MIRT1224565	hsa-miR-4499	CLIP-seq
MIRT1224566	hsa-miR-4505	CLIP-seq
MIRT1224567	hsa-miR-4521	CLIP-seq
MIRT1224568	hsa-miR-4642	CLIP-seq
MIRT1224569	hsa-miR-4646-5p	CLIP-seq
MIRT1224570	hsa-miR-4650-5p	CLIP-seq
MIRT1224571	hsa-miR-4693-3p	CLIP-seq
MIRT1224572	hsa-miR-4695-5p	CLIP-seq
MIRT1224573	hsa-miR-4722-5p	CLIP-seq
MIRT1224574	hsa-miR-4786-5p	CLIP-seq
MIRT1224575	hsa-miR-4793-3p	CLIP-seq
MIRT1224576	hsa-miR-508-5p	CLIP-seq
MIRT1224577	hsa-miR-548u	CLIP-seq
MIRT1224578	hsa-miR-612	CLIP-seq
MIRT1224579	hsa-miR-645	CLIP-seq
MIRT1224580	hsa-miR-658	CLIP-seq
MIRT1224581	hsa-miR-661	CLIP-seq
MIRT1224582	hsa-miR-665	CLIP-seq
MIRT1224583	hsa-miR-766	CLIP-seq
MIRT1224584	hsa-miR-767-5p	CLIP-seq
MIRT1224585	hsa-miR-96	CLIP-seq
MIRT2065497	hsa-miR-122	CLIP-seq
MIRT2065498	hsa-miR-1225-3p	CLIP-seq
MIRT2065499	hsa-miR-1229	CLIP-seq
MIRT2065500	hsa-miR-1233	CLIP-seq
MIRT2065501	hsa-miR-1246	CLIP-seq
MIRT2065502	hsa-miR-1273f	CLIP-seq
MIRT1224535	hsa-miR-1285	CLIP-seq
MIRT1224540	hsa-miR-2467-3p	CLIP-seq
MIRT2065503	hsa-miR-3134	CLIP-seq
MIRT2065504	hsa-miR-3135b	CLIP-seq
MIRT2065505	hsa-miR-3155	CLIP-seq
MIRT2065506	hsa-miR-3155b	CLIP-seq
MIRT1224544	hsa-miR-3187-5p	CLIP-seq
MIRT1224546	hsa-miR-3195	CLIP-seq
MIRT2065507	hsa-miR-3607-5p	CLIP-seq
MIRT2065508	hsa-miR-3614-5p	CLIP-seq
MIRT2065509	hsa-miR-3652	CLIP-seq
MIRT2065510	hsa-miR-3664-5p	CLIP-seq
MIRT1224554	hsa-miR-4257	CLIP-seq
MIRT2065511	hsa-miR-4320	CLIP-seq
MIRT2065512	hsa-miR-4430	CLIP-seq
MIRT2065513	hsa-miR-451b	CLIP-seq
MIRT2065514	hsa-miR-455-3p	CLIP-seq
MIRT2065515	hsa-miR-4634	CLIP-seq
MIRT2065516	hsa-miR-4639-3p	CLIP-seq
MIRT2065517	hsa-miR-4724-5p	CLIP-seq
MIRT2065518	hsa-miR-4766-3p	CLIP-seq
MIRT2065519	hsa-miR-4768-3p	CLIP-seq
MIRT1224574	hsa-miR-4786-5p	CLIP-seq
MIRT1224575	hsa-miR-4793-3p	CLIP-seq
MIRT2065520	hsa-miR-484	CLIP-seq
MIRT2065521	hsa-miR-5095	CLIP-seq
MIRT2065522	hsa-miR-510	CLIP-seq
MIRT2065523	hsa-miR-578	CLIP-seq
MIRT1224578	hsa-miR-612	CLIP-seq
MIRT1224581	hsa-miR-661	CLIP-seq
MIRT2065524	hsa-miR-668	CLIP-seq
MIRT2065497	hsa-miR-122	CLIP-seq
MIRT2065499	hsa-miR-1229	CLIP-seq
MIRT2065501	hsa-miR-1246	CLIP-seq
MIRT1224535	hsa-miR-1285	CLIP-seq
MIRT2293266	hsa-miR-146b-3p	CLIP-seq
MIRT1224539	hsa-miR-24	CLIP-seq
MIRT2293267	hsa-miR-302a	CLIP-seq
MIRT2293268	hsa-miR-302b	CLIP-seq
MIRT2293269	hsa-miR-302c	CLIP-seq
MIRT2293270	hsa-miR-302d	CLIP-seq
MIRT2293271	hsa-miR-302e	CLIP-seq
MIRT1224542	hsa-miR-31	CLIP-seq
MIRT2293272	hsa-miR-3126-3p	CLIP-seq
MIRT2065503	hsa-miR-3134	CLIP-seq
MIRT2065504	hsa-miR-3135b	CLIP-seq
MIRT2293273	hsa-miR-3140-5p	CLIP-seq
MIRT2065505	hsa-miR-3155	CLIP-seq
MIRT2065506	hsa-miR-3155b	CLIP-seq
MIRT2293274	hsa-miR-3173-5p	CLIP-seq
MIRT2293275	hsa-miR-3180	CLIP-seq
MIRT2293276	hsa-miR-3180-3p	CLIP-seq
MIRT1224544	hsa-miR-3187-5p	CLIP-seq
MIRT1224546	hsa-miR-3195	CLIP-seq
MIRT2293277	hsa-miR-3196	CLIP-seq
MIRT1224547	hsa-miR-339-5p	CLIP-seq
MIRT2293278	hsa-miR-3616-5p	CLIP-seq
MIRT2293279	hsa-miR-3622a-3p	CLIP-seq
MIRT2293280	hsa-miR-3622b-3p	CLIP-seq
MIRT2293281	hsa-miR-3647-5p	CLIP-seq
MIRT2065509	hsa-miR-3652	CLIP-seq
MIRT2065510	hsa-miR-3664-5p	CLIP-seq
MIRT2293282	hsa-miR-372	CLIP-seq
MIRT2293283	hsa-miR-373	CLIP-seq
MIRT2293284	hsa-miR-3926	CLIP-seq
MIRT2293285	hsa-miR-3940-3p	CLIP-seq
MIRT1224552	hsa-miR-4252	CLIP-seq
MIRT1224555	hsa-miR-4284	CLIP-seq
MIRT2293286	hsa-miR-4293	CLIP-seq
MIRT2065511	hsa-miR-4320	CLIP-seq
MIRT1224558	hsa-miR-4421	CLIP-seq
MIRT2065512	hsa-miR-4430	CLIP-seq
MIRT2293287	hsa-miR-4488	CLIP-seq
MIRT2065514	hsa-miR-455-3p	CLIP-seq
MIRT2065515	hsa-miR-4634	CLIP-seq
MIRT2065516	hsa-miR-4639-3p	CLIP-seq
MIRT2293288	hsa-miR-4697-5p	CLIP-seq
MIRT2293289	hsa-miR-4731-5p	CLIP-seq
MIRT2293290	hsa-miR-4749-3p	CLIP-seq
MIRT2293291	hsa-miR-4763-5p	CLIP-seq
MIRT1224574	hsa-miR-4786-5p	CLIP-seq
MIRT1224575	hsa-miR-4793-3p	CLIP-seq
MIRT2293292	hsa-miR-4795-5p	CLIP-seq
MIRT2065520	hsa-miR-484	CLIP-seq
MIRT1224576	hsa-miR-508-5p	CLIP-seq
MIRT2065522	hsa-miR-510	CLIP-seq
MIRT2293293	hsa-miR-512-3p	CLIP-seq
MIRT2293294	hsa-miR-520a-3p	CLIP-seq
MIRT2293295	hsa-miR-520b	CLIP-seq
MIRT2293296	hsa-miR-520c-3p	CLIP-seq
MIRT2293297	hsa-miR-520d-3p	CLIP-seq
MIRT2293298	hsa-miR-520e	CLIP-seq
MIRT2293299	hsa-miR-548s	CLIP-seq
MIRT2293300	hsa-miR-573	CLIP-seq
MIRT2293301	hsa-miR-596	CLIP-seq
MIRT1224578	hsa-miR-612	CLIP-seq
MIRT1224581	hsa-miR-661	CLIP-seq
MIRT2293302	hsa-miR-663b	CLIP-seq
MIRT2065524	hsa-miR-668	CLIP-seq
MIRT1224583	hsa-miR-766	CLIP-seq
MIRT2293303	hsa-miR-874	CLIP-seq
MIRT2065504	hsa-miR-3135b	CLIP-seq
MIRT2392368	hsa-miR-3158-3p	CLIP-seq
MIRT2392369	hsa-miR-3612	CLIP-seq
MIRT2065509	hsa-miR-3652	CLIP-seq
MIRT2065512	hsa-miR-4430	CLIP-seq
MIRT2392370	hsa-miR-4443	CLIP-seq
MIRT2392371	hsa-miR-4446-3p	CLIP-seq
MIRT2392372	hsa-miR-4492	CLIP-seq
MIRT2392373	hsa-miR-4498	CLIP-seq
MIRT2392374	hsa-miR-4717-5p	CLIP-seq
MIRT2392375	hsa-miR-650	CLIP-seq
MIRT2392376	hsa-miR-762	CLIP-seq
MIRT2456227	hsa-miR-3675-3p	CLIP-seq
MIRT2456228	hsa-miR-3925-3p	CLIP-seq
MIRT2456229	hsa-miR-4662a-5p	CLIP-seq
MIRT2456230	hsa-miR-4676-5p	CLIP-seq
MIRT2456231	hsa-miR-4684-5p	CLIP-seq
MIRT2456232	hsa-miR-4755-3p	CLIP-seq
MIRT2456233	hsa-miR-548c-3p	CLIP-seq
MIRT2456234	hsa-miR-549	CLIP-seq
MIRT2456235	hsa-miR-575	CLIP-seq
MIRT1224583	hsa-miR-766	CLIP-seq
MIRT2456227	hsa-miR-3675-3p	CLIP-seq
MIRT2456229	hsa-miR-4662a-5p	CLIP-seq
MIRT2456230	hsa-miR-4676-5p	CLIP-seq
MIRT2456231	hsa-miR-4684-5p	CLIP-seq
MIRT2456232	hsa-miR-4755-3p	CLIP-seq
MIRT2456233	hsa-miR-548c-3p	CLIP-seq
MIRT2456235	hsa-miR-575	CLIP-seq
MIRT2591312	hsa-miR-1273e	CLIP-seq
MIRT2591313	hsa-miR-146a	CLIP-seq
MIRT2591314	hsa-miR-146b-5p	CLIP-seq
MIRT2456227	hsa-miR-3675-3p	CLIP-seq
MIRT2456228	hsa-miR-3925-3p	CLIP-seq
MIRT2293284	hsa-miR-3926	CLIP-seq
MIRT1224560	hsa-miR-4459	CLIP-seq
MIRT2456229	hsa-miR-4662a-5p	CLIP-seq
MIRT2456230	hsa-miR-4676-5p	CLIP-seq
MIRT2456231	hsa-miR-4684-5p	CLIP-seq
MIRT1224572	hsa-miR-4695-5p	CLIP-seq
MIRT2456232	hsa-miR-4755-3p	CLIP-seq
MIRT2065519	hsa-miR-4768-3p	CLIP-seq
MIRT2456233	hsa-miR-548c-3p	CLIP-seq
MIRT2293299	hsa-miR-548s	CLIP-seq
MIRT2456234	hsa-miR-549	CLIP-seq
MIRT2456235	hsa-miR-575	CLIP-seq
MIRT1224580	hsa-miR-658	CLIP-seq
MIRT1224582	hsa-miR-665	CLIP-seq
MIRT1224583	hsa-miR-766	CLIP-seq
MIRT2591312	hsa-miR-1273e	CLIP-seq
MIRT2591313	hsa-miR-146a	CLIP-seq
MIRT2591314	hsa-miR-146b-5p	CLIP-seq
MIRT2456227	hsa-miR-3675-3p	CLIP-seq
MIRT2293284	hsa-miR-3926	CLIP-seq
MIRT1224560	hsa-miR-4459	CLIP-seq
MIRT2456229	hsa-miR-4662a-5p	CLIP-seq
MIRT2456230	hsa-miR-4676-5p	CLIP-seq
MIRT2456231	hsa-miR-4684-5p	CLIP-seq
MIRT1224572	hsa-miR-4695-5p	CLIP-seq
MIRT2456232	hsa-miR-4755-3p	CLIP-seq
MIRT2065519	hsa-miR-4768-3p	CLIP-seq
MIRT2456233	hsa-miR-548c-3p	CLIP-seq
MIRT2293299	hsa-miR-548s	CLIP-seq
MIRT2456235	hsa-miR-575	CLIP-seq
MIRT1224580	hsa-miR-658	CLIP-seq
MIRT1224582	hsa-miR-665	CLIP-seq
MIRT1224583	hsa-miR-766	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
GATA2	Unknown	9028949

Show/Hide all (67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001568	Process	Blood vessel development	IEA
GO:0001885	Process	Endothelial cell development	IEA
GO:0001886	Process	Endothelial cell morphogenesis	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	9162084, 9312087, 9774457, 10704309, 10801826, 15985432, 17580308, 18672896, 26607202, 28514442, 32814053
GO:0005615	Component	Extracellular space	IDA	9290466
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	17464107
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1690453
GO:0005911	Component	Cell-cell junction	IDA	15572031
GO:0005911	Component	Cell-cell junction	IEA
GO:0006909	Process	Phagocytosis	IDA	12110892
GO:0006909	Process	Phagocytosis	IEA
GO:0006955	Process	Immune response	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IMP	27958302
GO:0007159	Process	Leukocyte cell-cell adhesion	IMP	17580308
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	7994021
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IMP	15985432
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0008037	Process	Cell recognition	TAS	1690453
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	15572031
GO:0030485	Component	Smooth muscle contractile fiber	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031092	Component	Platelet alpha granule membrane	TAS
GO:0032991	Component	Protein-containing complex	IDA	26607202
GO:0035633	Process	Maintenance of blood-brain barrier	NAS	30280653
GO:0035696	Process	Monocyte extravasation	IMP	11078691
GO:0042060	Process	Wound healing	IEA
GO:0042311	Process	Vasodilation	IMP	26706435
GO:0042803	Function	Protein homodimerization activity	IDA	26702061, 27958302
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	15985432
GO:0043542	Process	Endothelial cell migration	IEA
GO:0044291	Component	Cell-cell contact zone	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0050904	Process	Diapedesis	IDA	19342684
GO:0050982	Process	Detection of mechanical stimulus	IMP	26706435
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	26706435
GO:0061028	Process	Establishment of endothelial barrier	IMP	7589563
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070161	Component	Anchoring junction	IEA
GO:0070830	Process	Bicellular tight junction assembly	IMP	26607202
GO:0071260	Process	Cellular response to mechanical stimulus	IMP	26706435
GO:0071260	Process	Cellular response to mechanical stimulus	IMP	15985432
GO:0071944	Component	Cell periphery	IEA
GO:0072011	Process	Glomerular endothelium development	IEP	17464107
GO:0072672	Process	Neutrophil extravasation	IMP	17580308, 22266279
GO:0090673	Process	Endothelial cell-matrix adhesion	IEA
GO:0098609	Process	Cell-cell adhesion	IDA	15572031
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IBA
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IMP	17580308
GO:0150107	Process	Positive regulation of protein localization to cell-cell junction	IDA	26706435
GO:1902533	Process	Positive regulation of intracellular signal transduction	IMP	26706435

MIM	HGNC	e!Ensembl
173445	8823	ENSG00000261371

P16284

Protein name

Platelet endothelial cell adhesion molecule (PECAM-1) (EndoCAM) (GPIIA') (PECA1) (CD antigen CD31)

Protein function

Cell adhesion molecule which is required for leukocyte transendothelial migration (TEM) under most inflammatory conditions (PubMed:17580308, PubMed:19342684). Tyr-690 plays a critical role in TEM and is required for efficient trafficking of PECA

PDB

2KY5 , 5C14 , 5GNI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13895	Ig_2	327 → 404	Immunoglobulin domain	Domain
PF17736	Ig_C17orf99	409 → 496	C17orf99 Ig domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed on platelets and leukocytes and is primarily concentrated at the borders between endothelial cells (PubMed:18388311, PubMed:21464369). Expressed in human umbilical vein endothelial cells (HUVECs) (at protein level) (PubMed:17

Sequence

MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFAD
VSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTT
AEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKRE
KNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHI
SPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHNRHGNKAVYSVMAMVEHSG
NYTCKVESSRISKVSSIVVNITELFSKPELESSFTHLDQGERLNLSCSIPGAPPANFTIQ
KEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFE
VIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADN
CHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREK
EGKPFYQMTSNATQAFWTKQKASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWK
KGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEAN
SHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAV
PDAVESRYSRTEGSLDGT

Sequence length

738

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis Cell adhesion molecules Leukocyte transendothelial migration Malaria Fluid shear stress and atherosclerosis		Platelet degranulation Cell surface interactions at the vascular wall PECAM1 interactions Integrin cell surface interactions Platelet sensitization by LDL Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, PSORIATIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY STENOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PECAM1 POLYMORPHISM	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Three Vessel Coronary Disease	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (382)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	22872639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	17638851, 20470859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	17704297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10815930, 16518857, 31646818, 8778572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16849681, 25347711, 31202132, 31592232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	24456477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19172414, 28695321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	22034877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	28695321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17638851, 20470859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	30079884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	24456477, 28695321		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha Thalassemia	Alpha thalassemia	Pubtator	32482310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30007166	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	30136914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	25267411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	18848929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angiokeratoma	Angiokeratoma	Pubtator	31169171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24069258, 30718678, 31597597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29957231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	21436157, 21817099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic disease	Pubtator	35460403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	24456477, 28695321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	15488875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12732396, 14575520, 15265022, 15589815, 15756041, 17460171, 18688018, 19183069, 20370486, 27997991, 28530674, 28712573, 28765521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	36012380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	BEFREE	29111303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	15742154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	23686519, 30127787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	23303013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15593185, 32365786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	31790075		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	21205894, 23264403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	23264403, 35858526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	19306055, 19428789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	12378388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12732396, 14575520, 15265022, 15589815, 15756041, 17460171, 18688018, 19183069, 20370486, 27997991, 28530674, 28712573, 28765521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	27997991, 32323830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	30007166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	LHGDN	17509538		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	17509538		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	CTD_human_DG	10848805		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11827998, 17467062		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31189740, 31640181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bardet-Biedl Syndrome	Bardet-Biedl Syndrome	BEFREE	17383815		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	27228385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	37162557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21206978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	31055613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	30663409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15168728, 20305783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	26277786, 32795351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11212228, 12651608, 1279332, 15810954, 24595984, 25353179, 26530780, 28534996, 29344258, 29459011, 29741783, 29845213, 30075800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18225549, 23139263, 31128060, 31535669, 32305991, 39235656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	30566624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33108070, 34358255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12651608, 15297858, 15585632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	29085834	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	12651608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22713659, 24045661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	11953822, 12651608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	30808776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21206978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23275310, 24390281, 26635184, 29970531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27637082, 30718678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17510564	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24086736, 26821530, 27031776, 31850854, 34358255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16681757, 17965528, 35761838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10926791, 19135712, 27567920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	37982389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	29115553	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	20704578, 23056178, 29115553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16990600, 20634489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	25267411, 32119531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	10082134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	30007166	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	37495324	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	17116209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	30321232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30458457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30458457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	11309161	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CHARGE Syndrome	CHARGE Syndrome	BEFREE	23747993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	17638851, 20470859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	30079884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	26173433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29031565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	32260158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	31144750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	19406964, 19424605, 30202981, 31475182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19715592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	27784320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	23264219, 30922293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	31344919, 7686339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	22872639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37055495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	7900941	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28940664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	24236063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23581409, 28002519, 28478181, 30250188, 30317880, 30792394, 31355161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23963148, 36327819, 37986009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital abnormality of vein	Venous malformation	BEFREE	23370410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	11844241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30767196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	21935395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15095478, 17510564, 21304051, 22213152, 31752390, 31850854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	29625453, 30348644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11796541, 12732396, 15265022, 15756041, 19183069, 28512385		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	28530674		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	12732396, 14575520, 15265022, 15589815, 15756041, 19183069, 20370486, 24339880, 28512385		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	12732396		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	24339880, 25267411, 28512385	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	28530674		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	27997991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12732396, 15265022, 15756041, 17460171, 19183069, 27997991, 28512385		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	21378988		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21378988		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Stenosis	Coronary Stenosis	BEFREE	15488875, 15589815, 15756041		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cushing Syndrome	Cushing`s Syndrome	BEFREE	28695321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	11839574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	17481912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	24081660, 25846278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15248213, 28367081, 31413818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29458014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	27759703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30312628, 30321232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28817576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22916176, 30321232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29164834, 29599497, 30312628, 30321232, 31294138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28116228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35109843	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30776253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	17264876	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	28116228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30001528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	12027924, 30191948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	28607806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	23335246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	30391968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	12651608, 15810954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	30836679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28498245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	31418859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	28158750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	35202881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	10926791, 19135712, 27567920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	BEFREE	23288560, 28658152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24777337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24777337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	24777337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24777337	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	29965884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	27938475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	28985034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	12215337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	22034877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	22470047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	26078569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	29344195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	30195618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	16565384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24868550, 26376118, 28252970, 28770500, 28938545, 29158223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33249476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24868550, 26376118, 28252970, 28770500, 28938545, 29158223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19306055, 23017339, 23760448, 28943909, 29427211, 31658577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Globoid cell leukodystrophy	Globoid Cell Leukodystrophy	BEFREE	31091708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	10193431, 34861820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	37170272	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	9551397	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	11564091, 11669217, 17178660, 8532023, 8977234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	19539218	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	11669217, 15753851, 15908974, 16980988, 21349261, 24831839, 8532023, 8977234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	7586686	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	7586686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	30084319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	21935395, 33874740, 36761158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	29784904	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	16456130, 9243511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	39337249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	27773560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	11520569, 18413650, 29084920, 29642150, 30723294, 9786357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	29084920, 30723294, 32795351, 35440765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	12842710, 17106245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16194886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	24225899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoid	Pubtator	40114371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	28231294, 7706478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	26232733	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	33912168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	31166803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytoma Angiomatoid Fibrous	Angiomatoid fibrous histiocytoma	Pubtator	26261484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	LHGDN	12653580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	27759703, 30124506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	12210089, 29746931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	1605306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Holt-Oram syndrome	Holt-Oram Syndrome	BEFREE	22849560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30793207, 31628816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	31146011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	30095998	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32888289, 33530152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29965884, 30312628, 31694504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	21930598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	30264480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27488544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27627890	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	19351758, 30999901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	24977625, 30586764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	17178660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	31398453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	23537525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	23370410, 29093274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile myofibromatosis	myofibromatosis	BEFREE	8600777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	38274228	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Female	Female infertility	Pubtator	38274228	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	27552332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28902041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29458014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	31144750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	30703600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	10702408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	39682704	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Meningioma	Intracranial Meningioma	BEFREE	28622532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	27924463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29935812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	22051146, 23056178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19183069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10199480, 10594750, 18413650, 25355615, 29660143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	31137972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	31850854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	19331133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29965884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	37400623, 37487574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	28404817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leishmaniasis	Leishmaniasis	Pubtator	23440109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12673718, 23180012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	17106245, 23180012, 23233201, 25837664, 29642150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23896391, 29938007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	17270454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	16594742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12017318, 16361537, 20101231, 24632756, 28359326, 28449718, 28651835, 29746931, 29935812, 30214510, 30439360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31344919, 7686339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	27090685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28651835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	22246909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	30124506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	23264341, 25201689, 2646323, 29400123, 30608206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	29247494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15297858, 16681757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	23747993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	28293817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	36899935	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	22753228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	30084319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	23537525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11212228, 12651608, 1279332, 15810954, 23139263, 24595984, 25353179, 26530780, 27612505, 28534996, 29344258, 29459011, 29741783, 29845213, 30075800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24777337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23275310, 24390281, 26635184, 29970531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12079305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23672538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21427164, 23978847, 28552967, 29974831, 31649488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28268166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	17549405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21206978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12943687, 16194886, 17106245, 23164239, 23918796, 24090655, 25976379, 29322789, 29523110, 30711931, 31085453, 31827511, 31828297, 31830411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30458457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28940664, 31420015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31378907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27693049, 30429890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	15607370, 23537525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	10547592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	30079884		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11553709, 16518857, 16882943, 21159176, 21212411, 27718503, 29387865, 29845213, 31752759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17429142, 37240247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	17429142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	LHGDN	12552497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	30808776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	36327819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29400123, 30979972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse	Mitral valve prolapse	Pubtator	27213335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	15482790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	17456996, 28512385, 28559658, 30728329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	17456996, 28512385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11532348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10713357, 10900349, 11827998, 12127674, 31024547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	17116209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	16412055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21535879, 21933581, 23180012, 25837664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	11795274, 14575520, 15488875, 23274712, 23906939, 26662939, 27914007, 28249798, 28453729, 28724653, 28757887, 30678728		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	23274712	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	28213360	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	11796541		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myofibromatosis	Myofibromatosis	BEFREE	8600777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	33135871	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30001734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10029078, 10741723, 10770643, 10815930, 11029496, 11358846, 11522651, 11861403, 11948141, 12209972, 12384424, 12532444, 12651608, 12759251, 12855648 View all (225 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	21910893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17383815, 26925422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus comedonicus	Nevus comedonicus	BEFREE	28599431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	17383815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10499626, 19654105, 24999479, 25081707, 28345466, 28861154, 29152147, 31387805, 31478461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	20704578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25857300, 29853224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29784904	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	37219669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	30672024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28471445, 30355920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	22226689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17483704, 29048647, 30890367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24548763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	28158750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21519794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34783299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	28660411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23672538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30718678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30136914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23054369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	23054369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28638676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	LHGDN	15731036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36148415, 38157091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	21468772		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	31612255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	23771798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	31411525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21427164, 23978847, 28552967, 29974831, 31649488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18767028, 23978847, 28552967, 33370412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	21725204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	28660411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	25519836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	24584739	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	25369198, 26748901, 29797802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	22801834, 30821336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	18029384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23635004, 27784320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	30836679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29088003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15095478, 17510564, 21304051, 27554585, 31752390, 31850854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17510564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	30099700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	22977664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	30628676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15248213, 15593185, 15742154, 25201689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	19539218	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	26191309, 35440765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	28404817, 30999901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	18029384	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	27159521, 33253099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	31540712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	10739703, 27301863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	22872639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	37553013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29933892, 31646818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24777337, 28151721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31744214, 32334476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	30084319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23343952, 30001714, 30575303, 30785217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	29211854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28710554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	19351758, 30999901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28268166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	16610000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	14606068, 30833656, 38050283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	30672024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	18413650, 23370410, 29093274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	30127787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	23897578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	27228385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	Pubtator	8080982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	38236412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	17549405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31846433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	18637101	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31705927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11569699, 28902041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27716046, 33238953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	24702909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19110305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	21119367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	28213360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous malformation	Venous malformation	BEFREE	23370410		★★★★★ ★☆☆☆☆ Found in Text Mining only

PECAM1 (platelet and endothelial cell adhesion molecule 1)