MSRB1 (methionine sulfoxide reductase B1)

Gene

• Entrez ID: 51734
• Gene name: Methionine sulfoxide reductase B1
• Gene symbol: MSRB1
• Synonyms (NCBI Gene): HSPC270, SELENOR, SELENOX, SELR, SELX, SEPX1, SepR
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: The protein encoded by this gene belongs to the methionine-R-sulfoxide reductase B (MsrB) family. Members of this family function as repair enzymes that protect proteins from oxidative stress by catalyzing the reduction of methionine-R-sulfoxides to methi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT045669	hsa-miR-149-5p	CLASH	23622248
MIRT656122	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT656120	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT656121	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT656119	hsa-miR-627-5p	HITS-CLIP	23824327
MIRT656118	hsa-miR-8081	HITS-CLIP	23824327
MIRT515286	hsa-miR-296-3p	PAR-CLIP	23446348
MIRT515285	hsa-miR-4755-3p	PAR-CLIP	23446348
MIRT515284	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT515283	hsa-miR-548s	PAR-CLIP	23446348
MIRT515282	hsa-miR-588	PAR-CLIP	23446348
MIRT515281	hsa-miR-4435	PAR-CLIP	23446348
MIRT515280	hsa-miR-3187-3p	PAR-CLIP	23446348
MIRT515279	hsa-miR-5096	PAR-CLIP	23446348
MIRT656122	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT656120	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT656121	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT656119	hsa-miR-627-5p	HITS-CLIP	23824327
MIRT656118	hsa-miR-8081	HITS-CLIP	23824327
MIRT515286	hsa-miR-296-3p	PAR-CLIP	23446348
MIRT515285	hsa-miR-4755-3p	PAR-CLIP	23446348
MIRT515284	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT515283	hsa-miR-548s	PAR-CLIP	23446348
MIRT515282	hsa-miR-588	PAR-CLIP	23446348
MIRT515281	hsa-miR-4435	PAR-CLIP	23446348
MIRT515280	hsa-miR-3187-3p	PAR-CLIP	23446348
MIRT515279	hsa-miR-5096	PAR-CLIP	23446348

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	ISS
GO:0005515	Function	Protein binding	IPI	23805218, 28579431, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	ISS	14699060
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0015629	Component	Actin cytoskeleton	ISS
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0030041	Process	Actin filament polymerization	IEA
GO:0030041	Process	Actin filament polymerization	ISS
GO:0030091	Process	Protein repair	IBA
GO:0030091	Process	Protein repair	IEA
GO:0030091	Process	Protein repair	ISS	14699060
GO:0030091	Process	Protein repair	TAS
GO:0033743	Function	Peptide-methionine (R)-S-oxide reductase activity	IBA
GO:0033743	Function	Peptide-methionine (R)-S-oxide reductase activity	IEA
GO:0033743	Function	Peptide-methionine (R)-S-oxide reductase activity	ISS
GO:0033743	Function	Peptide-methionine (R)-S-oxide reductase activity	TAS
GO:0033745	Function	L-methionine-(R)-S-oxide reductase activity	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	ISS
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 606216
• HGNC: 14133
• e!Ensembl: ENSG00000198736

Protein

• UniProt ID: Q9NZV6
• Protein name: Methionine-R-sulfoxide reductase B1 (MsrB1) (EC 1.8.4.12) (EC 1.8.4.14) (Selenoprotein X) (SelX)
• Protein function: Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-tra
• PDB: 3MAO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01641	SelR	5 → 105	SelR domain	Family

• Sequence:

  MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPE
  HNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRFUIFSSSLKFVPKGKETSASQGH

• Sequence length: 116

Pathways

Reactome:

Protein repair

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	23805218, 36497178	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17519015	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34719306	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	23270945		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22615972		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25541970, 34719306	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	36497178	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29861830		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22615972		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29395081, 29861830		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37033956	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34719306	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22615972, 25541970		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18081029		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	18081029		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18081029		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	37336980	Associate	★☆☆☆☆ Found in Text Mining only