Gene Gene information from NCBI Gene database.
Entrez ID 51710
Gene name Zinc finger protein 44
Gene symbol ZNF44
Synonyms (NCBI Gene)
GIOT-2KOX7ZNFZNF504ZNF55ZNF58
Chromosome 19
Chromosome location 19p13.2
miRNA miRNA information provided by mirtarbase database.
111
miRTarBase ID miRNA Experiments Reference
MIRT038754 hsa-miR-93-3p CLASH 23622248
MIRT610846 hsa-miR-4794 HITS-CLIP 23824327
MIRT610845 hsa-miR-664a-5p HITS-CLIP 23824327
MIRT610846 hsa-miR-4794 HITS-CLIP 23824327
MIRT610845 hsa-miR-664a-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
194542 13110 ENSG00000197857
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P15621
Protein name Zinc finger protein 44 (Gonadotropin-inducible ovary transcription repressor 2) (GIOT-2) (Zinc finger protein 55) (Zinc finger protein 58) (Zinc finger protein KOX7)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 51 92 KRAB box Family
PF00096 zf-C2H2 217 238 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 245 267 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 301 323 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 329 351 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 357 379 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 441 463 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 469 491 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 524 546 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 552 574 Zinc finger, C2H2 type Domain
PF13912 zf-C2H2_6 636 661 Domain
Sequence
MALCYGTFWGYPKMLEAANLMEGLVDIGPWVTLPRGQPEVLEWGLPKDQDSVAFEDVAVN
FTHEEWALLGPSQKNLYRDVMRETIRNLNCIG
MKWENQNIDDQHQNLRRNPRCDVVERFG
KSKDGSQCGETLSQIRNSIVNKNTPARVDACGSSVNGEVIMGHSSLNCYIRVDTGHKHRE
CHEYAEKSYTHKQCGKGLSYRHSFQTCERPHTGKKPYDCKECGKTFSSPGNLRRHMVVKG
GDGPYKCELCGKAFFWPSLLRMHERTHTGEKPYECKQCSKAFPVYSSYLRHEKIHTGEKP
YECKQCSKAFPDYSSYLRHERTHTGEKPYKCKQCGKAFSVSGSLRVHERIHTGEKPYTCK
QCGKAFCHLGSFQRHMIMH
SGDGPHKCKICGKGFDFPGSARIHEGTHTLEKPYECKQCGK
LLSHRSSFRRHMMAHTGDGPHKCTVCGKAFDSPSVFQRHERTHTGEKPYECKQCGKAFRT
SSSLRKHETTH
TGEQPYKCKCGKAFSDLFSFQSHETTHSEEEPYECKECGKAFSSFKYFC
RHERTH
SEEKSYECQICGKAFSRFSYLKTHERTHTAEKPYECKQCRKAFFWPSFLLRHER
THTGERPYECKHCGKAFSRSSFCREHERTHTGEKPYECKECGKAFSSLSSFNRHKRTHWK
D
IL
Sequence length 663
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
OLIGODENDROGLIOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Beckwith-Wiedemann Syndrome Beckwith-Wiedemann Syndrome BEFREE 7557990
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 25421577
★☆☆☆☆
Found in Text Mining only
Choroid Plexus Papilloma Choroid Plexus Papilloma BEFREE 30466473
★☆☆☆☆
Found in Text Mining only
Epilepsy Generalized Generalized epilepsy Pubtator 23686817 Associate
★☆☆☆☆
Found in Text Mining only
Epilepsy, Generalized Epilepsy BEFREE 23686817
★☆☆☆☆
Found in Text Mining only
Gastrointestinal Stromal Tumors Gastrointestinal stromal tumor BEFREE 19671739, 23372733, 24124608
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 25421577
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of lung Lung Cancer BEFREE 30444046
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 27655485, 28670441, 29370947, 30444046
★☆☆☆☆
Found in Text Mining only
Multiple Myeloma Multiple myeloma BEFREE 31165610
★☆☆☆☆
Found in Text Mining only