Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5168
Gene name	Ectonucleotide pyrophosphatase/phosphodiesterase 2
Gene symbol	ENPP2
Synonyms (NCBI Gene)	ATXATX-XAUTOTAXINLysoPLDNPP2PD-IALPHAPDNP2
Chromosome	8
Chromosome location	8q24.12
Summary	The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5` end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evoke

134

Show/Hide all (134)

miRTarBase ID	miRNA	Experiments	Reference
MIRT537688	hsa-miR-29a-3p	PAR-CLIP	22012620
MIRT537687	hsa-miR-29b-3p	PAR-CLIP	22012620
MIRT537686	hsa-miR-29c-3p	PAR-CLIP	22012620
MIRT537685	hsa-miR-107	PAR-CLIP	22012620
MIRT537684	hsa-miR-103a-3p	PAR-CLIP	22012620
MIRT537683	hsa-miR-4762-5p	PAR-CLIP	22012620
MIRT537682	hsa-miR-3065-3p	PAR-CLIP	22012620
MIRT537681	hsa-miR-3158-5p	PAR-CLIP	22012620
MIRT537680	hsa-miR-1184	PAR-CLIP	22012620
MIRT537679	hsa-miR-1205	PAR-CLIP	22012620
MIRT537678	hsa-miR-17-3p	PAR-CLIP	22012620
MIRT537677	hsa-miR-767-5p	PAR-CLIP	22012620
MIRT537688	hsa-miR-29a-3p	PAR-CLIP	22012620
MIRT537687	hsa-miR-29b-3p	PAR-CLIP	22012620
MIRT537686	hsa-miR-29c-3p	PAR-CLIP	22012620
MIRT537685	hsa-miR-107	PAR-CLIP	22012620
MIRT537684	hsa-miR-103a-3p	PAR-CLIP	22012620
MIRT537683	hsa-miR-4762-5p	PAR-CLIP	22012620
MIRT537682	hsa-miR-3065-3p	PAR-CLIP	22012620
MIRT537681	hsa-miR-3158-5p	PAR-CLIP	22012620
MIRT537680	hsa-miR-1184	PAR-CLIP	22012620
MIRT537679	hsa-miR-1205	PAR-CLIP	22012620
MIRT537678	hsa-miR-17-3p	PAR-CLIP	22012620
MIRT537677	hsa-miR-767-5p	PAR-CLIP	22012620
MIRT964016	hsa-miR-4484	CLIP-seq
MIRT964017	hsa-miR-520d-5p	CLIP-seq
MIRT964018	hsa-miR-524-5p	CLIP-seq
MIRT964019	hsa-miR-548an	CLIP-seq
MIRT964020	hsa-miR-891b	CLIP-seq
MIRT2448862	hsa-miR-1263	CLIP-seq
MIRT2448863	hsa-miR-3159	CLIP-seq
MIRT2448864	hsa-miR-4700-3p	CLIP-seq
MIRT2524041	hsa-miR-101	CLIP-seq
MIRT2524042	hsa-miR-103a	CLIP-seq
MIRT2524043	hsa-miR-1238	CLIP-seq
MIRT2524044	hsa-miR-144	CLIP-seq
MIRT2524045	hsa-miR-2115	CLIP-seq
MIRT2524046	hsa-miR-29a	CLIP-seq
MIRT2524047	hsa-miR-29b	CLIP-seq
MIRT2524048	hsa-miR-29c	CLIP-seq
MIRT2524049	hsa-miR-300	CLIP-seq
MIRT2524050	hsa-miR-3120-3p	CLIP-seq
MIRT2524051	hsa-miR-3143	CLIP-seq
MIRT2524052	hsa-miR-3148	CLIP-seq
MIRT2524053	hsa-miR-3161	CLIP-seq
MIRT2524054	hsa-miR-3163	CLIP-seq
MIRT2524055	hsa-miR-338-5p	CLIP-seq
MIRT2524056	hsa-miR-33a	CLIP-seq
MIRT2524057	hsa-miR-33b	CLIP-seq
MIRT2524058	hsa-miR-3647-3p	CLIP-seq
MIRT2524059	hsa-miR-3671	CLIP-seq
MIRT2524060	hsa-miR-3688-5p	CLIP-seq
MIRT2524061	hsa-miR-381	CLIP-seq
MIRT2524062	hsa-miR-3978	CLIP-seq
MIRT2524063	hsa-miR-4302	CLIP-seq
MIRT2524064	hsa-miR-4432	CLIP-seq
MIRT2524065	hsa-miR-4436b-5p	CLIP-seq
MIRT964016	hsa-miR-4484	CLIP-seq
MIRT2524066	hsa-miR-4666-3p	CLIP-seq
MIRT2448864	hsa-miR-4700-3p	CLIP-seq
MIRT2524067	hsa-miR-4759	CLIP-seq
MIRT2524068	hsa-miR-499-5p	CLIP-seq
MIRT964017	hsa-miR-520d-5p	CLIP-seq
MIRT964018	hsa-miR-524-5p	CLIP-seq
MIRT2524069	hsa-miR-543	CLIP-seq
MIRT2524070	hsa-miR-545	CLIP-seq
MIRT2524071	hsa-miR-548ac	CLIP-seq
MIRT2524072	hsa-miR-548ae	CLIP-seq
MIRT2524073	hsa-miR-548aj	CLIP-seq
MIRT2524074	hsa-miR-548am	CLIP-seq
MIRT964019	hsa-miR-548an	CLIP-seq
MIRT2524075	hsa-miR-548c-3p	CLIP-seq
MIRT2524076	hsa-miR-548d-3p	CLIP-seq
MIRT2524077	hsa-miR-548x	CLIP-seq
MIRT2524078	hsa-miR-548z	CLIP-seq
MIRT2524079	hsa-miR-587	CLIP-seq
MIRT2524080	hsa-miR-607	CLIP-seq
MIRT2524081	hsa-miR-889	CLIP-seq
MIRT964020	hsa-miR-891b	CLIP-seq
MIRT2524041	hsa-miR-101	CLIP-seq
MIRT2524042	hsa-miR-103a	CLIP-seq
MIRT2524043	hsa-miR-1238	CLIP-seq
MIRT2680071	hsa-miR-132	CLIP-seq
MIRT2524044	hsa-miR-144	CLIP-seq
MIRT2524045	hsa-miR-2115	CLIP-seq
MIRT2680072	hsa-miR-212	CLIP-seq
MIRT2680073	hsa-miR-299-5p	CLIP-seq
MIRT2524046	hsa-miR-29a	CLIP-seq
MIRT2524047	hsa-miR-29b	CLIP-seq
MIRT2524048	hsa-miR-29c	CLIP-seq
MIRT2524049	hsa-miR-300	CLIP-seq
MIRT2524050	hsa-miR-3120-3p	CLIP-seq
MIRT2524051	hsa-miR-3143	CLIP-seq
MIRT2524052	hsa-miR-3148	CLIP-seq
MIRT2524054	hsa-miR-3163	CLIP-seq
MIRT2524055	hsa-miR-338-5p	CLIP-seq
MIRT2524056	hsa-miR-33a	CLIP-seq
MIRT2524057	hsa-miR-33b	CLIP-seq
MIRT2524058	hsa-miR-3647-3p	CLIP-seq
MIRT2680074	hsa-miR-3658	CLIP-seq
MIRT2524059	hsa-miR-3671	CLIP-seq
MIRT2524060	hsa-miR-3688-5p	CLIP-seq
MIRT2524061	hsa-miR-381	CLIP-seq
MIRT2524062	hsa-miR-3978	CLIP-seq
MIRT2524063	hsa-miR-4302	CLIP-seq
MIRT2680075	hsa-miR-4307	CLIP-seq
MIRT2524065	hsa-miR-4436b-5p	CLIP-seq
MIRT964016	hsa-miR-4484	CLIP-seq
MIRT2524066	hsa-miR-4666-3p	CLIP-seq
MIRT2448864	hsa-miR-4700-3p	CLIP-seq
MIRT2524067	hsa-miR-4759	CLIP-seq
MIRT2680076	hsa-miR-4795-3p	CLIP-seq
MIRT2680077	hsa-miR-509-3p	CLIP-seq
MIRT964017	hsa-miR-520d-5p	CLIP-seq
MIRT964018	hsa-miR-524-5p	CLIP-seq
MIRT2524069	hsa-miR-543	CLIP-seq
MIRT2524070	hsa-miR-545	CLIP-seq
MIRT2680078	hsa-miR-548a-3p	CLIP-seq
MIRT2524071	hsa-miR-548ac	CLIP-seq
MIRT2524072	hsa-miR-548ae	CLIP-seq
MIRT2524073	hsa-miR-548aj	CLIP-seq
MIRT2524074	hsa-miR-548am	CLIP-seq
MIRT964019	hsa-miR-548an	CLIP-seq
MIRT2524075	hsa-miR-548c-3p	CLIP-seq
MIRT2524076	hsa-miR-548d-3p	CLIP-seq
MIRT2680079	hsa-miR-548e	CLIP-seq
MIRT2680080	hsa-miR-548f	CLIP-seq
MIRT2524077	hsa-miR-548x	CLIP-seq
MIRT2524078	hsa-miR-548z	CLIP-seq
MIRT2680081	hsa-miR-556-3p	CLIP-seq
MIRT2524079	hsa-miR-587	CLIP-seq
MIRT2524080	hsa-miR-607	CLIP-seq
MIRT2524081	hsa-miR-889	CLIP-seq
MIRT964020	hsa-miR-891b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
NFATC2	Unknown	22986745

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0004528	Function	Phosphodiesterase I activity	IBA
GO:0004528	Function	Phosphodiesterase I activity	TAS	7982964
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	IBA
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	IDA	12354767, 14500380, 15280042, 21240271, 21393252, 26371182
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	IEA
GO:0004630	Function	Phospholipase D activity	IEA
GO:0005044	Function	Scavenger receptor activity	IEA
GO:0005509	Function	Calcium ion binding	IDA	26371182
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	ISS
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	15280042, 26371182
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0005886	Component	Plasma membrane	TAS	8579579
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	NAS	7982964
GO:0006955	Process	Immune response	IEA
GO:0008270	Function	Zinc ion binding	IDA	26371182
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	ISS
GO:0009395	Process	Phospholipid catabolic process	IDA	15280042, 26371182
GO:0010634	Process	Positive regulation of epithelial cell migration	IGI	18054784
GO:0010634	Process	Positive regulation of epithelial cell migration	IMP	18054784
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016787	Function	Hydrolase activity	TAS	7982964
GO:0030149	Process	Sphingolipid catabolic process	IDA	14500380
GO:0030247	Function	Polysaccharide binding	IEA
GO:0030334	Process	Regulation of cell migration	IDA	1733949
GO:0034638	Process	Phosphatidylcholine catabolic process	IBA
GO:0034638	Process	Phosphatidylcholine catabolic process	IDA	21240271
GO:0034638	Process	Phosphatidylcholine catabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0047391	Function	Alkylglycerophosphoethanolamine phosphodiesterase activity	IBA
GO:0047391	Function	Alkylglycerophosphoethanolamine phosphodiesterase activity	IEA
GO:0048870	Process	Cell motility	TAS	1733949
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	18054784
GO:2000394	Process	Positive regulation of lamellipodium morphogenesis	IGI	18054784

MIM	HGNC	e!Ensembl
601060	3357	ENSG00000136960

Q13822

Protein name

Autotaxin (EC 3.1.4.39) (EC 3.1.4.4) (Ectonucleotide pyrophosphatase/phosphodiesterase family member 2) (E-NPP 2) (Extracellular lysophospholipase D) (LysoPLD)

Protein function

Secreted lysophospholipase D that hydrolyzes lysophospholipids to produce the signaling molecule lysophosphatidic acid (LPA) in extracellular fluids (PubMed:12354767, PubMed:14500380, PubMed:15769751, PubMed:26371182, PubMed:27754931). Its major

PDB

4ZG6 , 4ZG7 , 4ZG9 , 4ZGA , 5KXA , 5M7M , 5MHP , 8C3O , 8C3P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01033	Somatomedin_B	57 → 97	Somatomedin B domain	Family
PF01033	Somatomedin_B	101 → 141	Somatomedin B domain	Family
PF01663	Phosphodiest	166 → 478	Type I phosphodiesterase / nucleotide pyrophosphatase	Family
PF01223	Endonuclease_NS	602 → 845	DNA/RNA non-specific endonuclease	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in blood plasma (at protein level) (PubMed:12176993, PubMed:26371182). Predominantly expressed in brain, placenta, ovary, and small intestine. Expressed in a number of carcinomas such as hepatocellular and prostate carcinoma,

Sequence

MARRSSFQSCQIISLFTFAVGVNICLGFTAHRIKRAEGWEEGPPTVLSDSPWTNISGSCK
GRCFELQEAGPPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHC
SEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMK
KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA
TFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDHER
PSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDH
GMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLTCKKPDQH
FKPYLKQHLPKRLHYANNRRIEDIHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNK
VNSMQTVFVGYGSTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTF
RPTMPEEVTRPNYPGIMYLQSDFDLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYG
RPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYTVSKQAEVSSVPDHLTSCVRPDVRVS
PSFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVL
VKKYASERNGVNVISGPIFDYDYDGLHDTEDKIKQYVEGSSIPVPTHYYSIITSCLDFTQ
PADKCDGPLSVSSFILPHRPDNEESCNSSEDESKWVEELMKMHTARVRDIEHLTSLDFFR
KTSRSYPEILTLKTYLHTYESEI

Sequence length

863

Interactions

View interactions

	KEGG		Reactome
	Ether lipid metabolism Metabolic pathways		Vitamin B5 (pantothenate) metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC PERSISTENT HEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, CHRONIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (117)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	17902023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxia oculomotor Cogan type	Apraxia	Pubtator	34193451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	22493518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11168012	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	36493768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	16529861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	37460234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	17044071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	28052132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	28052132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	19139100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	21234797	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15897878, 16601922, 19477432, 30921203, 31548293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19204929, 21647386, 22140473, 22922883, 24277575, 31035435, 32412047, 35365723, 35409077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30567518	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19222837, 22140473, 30984544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20356387, 21765444, 27583415, 28598712, 29414802, 37543832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	31455351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27757783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17671719, 29724718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	11720477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	34193451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	34193451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28356001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	34576169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	17902023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	34389475	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	34389475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	31102124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	32396387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30481488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	34564978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32953885, 34769391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	28052132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24122794, 27757783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	32396387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	22991566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	16977444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30821134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	36012446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	21617900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29328374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	28758906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27981605, 28052132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	15027116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	39426076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	37550785, 39426076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	34140021	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15720813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	16627485, 19204929	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17928955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15720813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	29414802	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19204929	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	15933052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	15933052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	30317243	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	35409077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	31194638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	BEFREE	17963703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22744859, 31550726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31093829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	34389475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23377000	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35528167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	24852265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11593532, 17902023, 28126468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17902023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	17577119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	20356387, 27583415, 28052132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	30735608	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	26083365, 28052132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	28052132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	34717796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	26083365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16601922, 19477432, 30921203, 31548293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	17902023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17671719, 29724718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17044071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22260662, 26391552, 27981605, 30921203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12498389, 16356477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11168012, 12482591, 16627485, 19204929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21647386	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	24969110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	30821134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	23936203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30367882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11559573, 15027116, 22142333, 28126468, 29414802		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28356001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22975311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	9192834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	37460234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24969110, 28170448		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18337445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18337445, 34065317, 35552618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18497954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17044071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19549252, 37543832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	30735608	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24122794, 27757783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11168012, 26391552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24852265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	16977444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar ataxia 27	Spinocerebellar ataxia	Pubtator	37460234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 7	Spinocerebellar Ataxia	BEFREE	23347954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	39426076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	16977444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	31455351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	15027116, 18497954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	26037280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	26037280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	15027116, 18497954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	26037280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	23558934	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Neoplasms	Thyroid cancer	Pubtator	31455351	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal melanoma	Pubtator	17475713	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34576169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ENPP2 (ectonucleotide pyrophosphatase/phosphodiesterase 2)