Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51666
Gene name	Ankyrin repeat and SOCS box containing 4
Gene symbol	ASB4
Synonyms (NCBI Gene)	ASB-4
Chromosome	7
Chromosome location	7q21.3
Summary	The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins

113

Show/Hide all (113)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019059	hsa-miR-335-5p	Microarray	18185580
MIRT450019	hsa-miR-181b-2-3p	PAR-CLIP	22100165
MIRT450018	hsa-miR-181b-3p	PAR-CLIP	22100165
MIRT450017	hsa-miR-4420	PAR-CLIP	22100165
MIRT450016	hsa-miR-6869-5p	PAR-CLIP	22100165
MIRT450019	hsa-miR-181b-2-3p	PAR-CLIP	22100165
MIRT450018	hsa-miR-181b-3p	PAR-CLIP	22100165
MIRT450017	hsa-miR-4420	PAR-CLIP	22100165
MIRT450016	hsa-miR-6869-5p	PAR-CLIP	22100165
MIRT802275	hsa-miR-1179	CLIP-seq
MIRT802276	hsa-miR-1200	CLIP-seq
MIRT802277	hsa-miR-1202	CLIP-seq
MIRT802278	hsa-miR-140-5p	CLIP-seq
MIRT802279	hsa-miR-181a	CLIP-seq
MIRT802280	hsa-miR-181b	CLIP-seq
MIRT802281	hsa-miR-181c	CLIP-seq
MIRT802282	hsa-miR-181d	CLIP-seq
MIRT802283	hsa-miR-1912	CLIP-seq
MIRT802284	hsa-miR-3130-5p	CLIP-seq
MIRT802285	hsa-miR-3143	CLIP-seq
MIRT802286	hsa-miR-3145-3p	CLIP-seq
MIRT802287	hsa-miR-3159	CLIP-seq
MIRT802288	hsa-miR-34a	CLIP-seq
MIRT802289	hsa-miR-34c-5p	CLIP-seq
MIRT802290	hsa-miR-3545-5p	CLIP-seq
MIRT802291	hsa-miR-3591-5p	CLIP-seq
MIRT802292	hsa-miR-3618	CLIP-seq
MIRT802293	hsa-miR-3682-5p	CLIP-seq
MIRT802294	hsa-miR-3972	CLIP-seq
MIRT802295	hsa-miR-4262	CLIP-seq
MIRT802296	hsa-miR-4291	CLIP-seq
MIRT802297	hsa-miR-4310	CLIP-seq
MIRT802298	hsa-miR-4324	CLIP-seq
MIRT802299	hsa-miR-4424	CLIP-seq
MIRT802300	hsa-miR-4460	CLIP-seq
MIRT802301	hsa-miR-4482	CLIP-seq
MIRT802302	hsa-miR-449a	CLIP-seq
MIRT802303	hsa-miR-449b	CLIP-seq
MIRT802304	hsa-miR-4682	CLIP-seq
MIRT802305	hsa-miR-4711-3p	CLIP-seq
MIRT802306	hsa-miR-4727-3p	CLIP-seq
MIRT802307	hsa-miR-543	CLIP-seq
MIRT802308	hsa-miR-544b	CLIP-seq
MIRT802309	hsa-miR-548g	CLIP-seq
MIRT802310	hsa-miR-587	CLIP-seq
MIRT802311	hsa-miR-892a	CLIP-seq
MIRT802312	hsa-miR-934	CLIP-seq
MIRT802313	hsa-let-7a	CLIP-seq
MIRT802314	hsa-let-7b	CLIP-seq
MIRT802315	hsa-let-7c	CLIP-seq
MIRT802316	hsa-let-7d	CLIP-seq
MIRT802317	hsa-let-7e	CLIP-seq
MIRT802318	hsa-let-7f	CLIP-seq
MIRT802319	hsa-let-7g	CLIP-seq
MIRT802320	hsa-let-7i	CLIP-seq
MIRT802321	hsa-miR-196a	CLIP-seq
MIRT802322	hsa-miR-196b	CLIP-seq
MIRT802323	hsa-miR-383	CLIP-seq
MIRT802324	hsa-miR-4257	CLIP-seq
MIRT802325	hsa-miR-4458	CLIP-seq
MIRT802326	hsa-miR-4500	CLIP-seq
MIRT802327	hsa-miR-98	CLIP-seq
MIRT802276	hsa-miR-1200	CLIP-seq
MIRT1936866	hsa-miR-1323	CLIP-seq
MIRT802293	hsa-miR-3682-5p	CLIP-seq
MIRT802298	hsa-miR-4324	CLIP-seq
MIRT802299	hsa-miR-4424	CLIP-seq
MIRT1936867	hsa-miR-4645-3p	CLIP-seq
MIRT802304	hsa-miR-4682	CLIP-seq
MIRT1936868	hsa-miR-4757-5p	CLIP-seq
MIRT1936869	hsa-miR-542-3p	CLIP-seq
MIRT802308	hsa-miR-544b	CLIP-seq
MIRT1936870	hsa-miR-548o	CLIP-seq
MIRT1936871	hsa-miR-548p	CLIP-seq
MIRT802310	hsa-miR-587	CLIP-seq
MIRT2176681	hsa-miR-106a	CLIP-seq
MIRT2176682	hsa-miR-106b	CLIP-seq
MIRT2176683	hsa-miR-17	CLIP-seq
MIRT2176684	hsa-miR-20a	CLIP-seq
MIRT2176685	hsa-miR-20b	CLIP-seq
MIRT2176686	hsa-miR-3177-5p	CLIP-seq
MIRT2176687	hsa-miR-3691-3p	CLIP-seq
MIRT2176688	hsa-miR-4267	CLIP-seq
MIRT2176689	hsa-miR-4519	CLIP-seq
MIRT1936868	hsa-miR-4757-5p	CLIP-seq
MIRT2176690	hsa-miR-519d	CLIP-seq
MIRT2176691	hsa-miR-766	CLIP-seq
MIRT2176692	hsa-miR-93	CLIP-seq
MIRT802293	hsa-miR-3682-5p	CLIP-seq
MIRT2444077	hsa-miR-4426	CLIP-seq
MIRT2444078	hsa-miR-4470	CLIP-seq
MIRT2444079	hsa-miR-4647	CLIP-seq
MIRT2444080	hsa-miR-4652-3p	CLIP-seq
MIRT2444081	hsa-miR-4662b	CLIP-seq
MIRT2444082	hsa-miR-4778-5p	CLIP-seq
MIRT2444077	hsa-miR-4426	CLIP-seq
MIRT2444078	hsa-miR-4470	CLIP-seq
MIRT2444079	hsa-miR-4647	CLIP-seq
MIRT2444080	hsa-miR-4652-3p	CLIP-seq
MIRT2444081	hsa-miR-4662b	CLIP-seq
MIRT2444082	hsa-miR-4778-5p	CLIP-seq
MIRT2444077	hsa-miR-4426	CLIP-seq
MIRT2444078	hsa-miR-4470	CLIP-seq
MIRT2444079	hsa-miR-4647	CLIP-seq
MIRT2444080	hsa-miR-4652-3p	CLIP-seq
MIRT2444081	hsa-miR-4662b	CLIP-seq
MIRT2444082	hsa-miR-4778-5p	CLIP-seq
MIRT2444077	hsa-miR-4426	CLIP-seq
MIRT2444078	hsa-miR-4470	CLIP-seq
MIRT2444079	hsa-miR-4647	CLIP-seq
MIRT2444080	hsa-miR-4652-3p	CLIP-seq
MIRT2444081	hsa-miR-4662b	CLIP-seq
MIRT2444082	hsa-miR-4778-5p	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	ISS
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0031462	Component	Cul2-RING ubiquitin ligase complex	IDA	17636018
GO:0031462	Component	Cul2-RING ubiquitin ligase complex	IEA
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IDA	17636018
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	ISS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0051865	Process	Protein autoubiquitination	IEA
GO:0051865	Process	Protein autoubiquitination	ISS
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:2001214	Process	Positive regulation of vasculogenesis	IEA
GO:2001214	Process	Positive regulation of vasculogenesis	ISS

MIM	HGNC	e!Ensembl
605761	16009	ENSG00000005981

Q9Y574

Protein name

Ankyrin repeat and SOCS box protein 4 (ASB-4)

Protein function

Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes differentiatio

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12796	Ank_2	79 → 170	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	144 → 249	Ankyrin repeats (3 copies)	Repeat
PF07525	SOCS_box	381 → 420	SOCS box	Domain

Sequence

MDGTTAPVTKSGAAKLVKRNFLEALKSNDFGKLKAILIQRQIDVDTVFEVEDENMVLASY
KQGYWLPSYKLKSSWATGLHLSVLFGHVECLLVLLDHNATINCRPNGKTPLHVACEMANV
DCVKILCDRGAKLNCYSLSGHTALHFCTTPSSILCAKQLVWRGANVNMKTNNQDEETPLH
TAAHFGLSELVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEHHLVCRMLLD
YKAEVNARDDDFKSPLHKAAWNCDHVLMHMMLEAGAEANLMDINGCAAIQYVLKVTSVRP
AAQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIRWNTKWRRAIPD
DDLEKYWDFYHSLFTVCCNSPRTLMHLSRCAIRRTLHNRCHRAIPLLSLPLSLKKYLLLE
PEGIIY

Sequence length

426

Interactions

View interactions

	Reactome
			Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24815387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29371260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36194576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29371260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29371260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36194576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ASB4 (ankyrin repeat and SOCS box containing 4)