Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51655
Gene name	Ras related dexamethasone induced 1
Gene symbol	RASD1
Synonyms (NCBI Gene)	AGS1DEXRAS1MGC:26290
Chromosome	17
Chromosome location	17p11.2
Summary	This gene encodes a member of the Ras superfamily of small GTPases and is induced by dexamethasone. The encoded protein is an activator of G-protein signaling and acts as a direct nucleotide exchange factor for Gi-Go proteins. This protein interacts with

253

Show/Hide all (253)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004439	hsa-miR-375	Luciferase reporter assayMicroarrayqRT-PCR	20978187
MIRT018256	hsa-miR-335-5p	Microarray	18185580
MIRT492476	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT492475	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT492474	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT492473	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT492471	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT492472	hsa-miR-3175	PAR-CLIP	20371350
MIRT492470	hsa-miR-3180	PAR-CLIP	20371350
MIRT492469	hsa-miR-3180-3p	PAR-CLIP	20371350
MIRT492468	hsa-miR-3196	PAR-CLIP	20371350
MIRT492467	hsa-miR-6816-5p	PAR-CLIP	20371350
MIRT492466	hsa-miR-1237-5p	PAR-CLIP	20371350
MIRT492465	hsa-miR-4488	PAR-CLIP	20371350
MIRT492464	hsa-miR-4697-5p	PAR-CLIP	20371350
MIRT492476	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT492475	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT492474	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT492473	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT492471	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT492472	hsa-miR-3175	PAR-CLIP	20371350
MIRT492470	hsa-miR-3180	PAR-CLIP	20371350
MIRT492469	hsa-miR-3180-3p	PAR-CLIP	20371350
MIRT492468	hsa-miR-3196	PAR-CLIP	20371350
MIRT492467	hsa-miR-6816-5p	PAR-CLIP	20371350
MIRT492466	hsa-miR-1237-5p	PAR-CLIP	20371350
MIRT492465	hsa-miR-4488	PAR-CLIP	20371350
MIRT492464	hsa-miR-4697-5p	PAR-CLIP	20371350
MIRT492476	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT492475	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT492474	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT492473	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT492471	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT492472	hsa-miR-3175	PAR-CLIP	23592263
MIRT492470	hsa-miR-3180	PAR-CLIP	23592263
MIRT492469	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT492468	hsa-miR-3196	PAR-CLIP	23592263
MIRT492467	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT492466	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT492465	hsa-miR-4488	PAR-CLIP	23592263
MIRT492464	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT492466	hsa-miR-1237-5p	PAR-CLIP	26701625
MIRT492476	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT492476	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT492476	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT492476	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT492476	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT492475	hsa-miR-149-3p	PAR-CLIP	26701625
MIRT492475	hsa-miR-149-3p	PAR-CLIP	26701625
MIRT492475	hsa-miR-149-3p	PAR-CLIP	26701625
MIRT492475	hsa-miR-149-3p	PAR-CLIP	26701625
MIRT492475	hsa-miR-149-3p	PAR-CLIP	26701625
MIRT492472	hsa-miR-3175	PAR-CLIP	26701625
MIRT492472	hsa-miR-3175	PAR-CLIP	26701625
MIRT492472	hsa-miR-3175	PAR-CLIP	26701625
MIRT492472	hsa-miR-3175	PAR-CLIP	26701625
MIRT492472	hsa-miR-3175	PAR-CLIP	26701625
MIRT492469	hsa-miR-3180-3p	PAR-CLIP	26701625
MIRT492469	hsa-miR-3180-3p	PAR-CLIP	26701625
MIRT492469	hsa-miR-3180-3p	PAR-CLIP	26701625
MIRT492469	hsa-miR-3180-3p	PAR-CLIP	26701625
MIRT492469	hsa-miR-3180-3p	PAR-CLIP	26701625
MIRT492470	hsa-miR-3180	PAR-CLIP	26701625
MIRT492470	hsa-miR-3180	PAR-CLIP	26701625
MIRT492470	hsa-miR-3180	PAR-CLIP	26701625
MIRT492470	hsa-miR-3180	PAR-CLIP	26701625
MIRT492470	hsa-miR-3180	PAR-CLIP	26701625
MIRT492468	hsa-miR-3196	PAR-CLIP	26701625
MIRT492468	hsa-miR-3196	PAR-CLIP	26701625
MIRT492468	hsa-miR-3196	PAR-CLIP	26701625
MIRT492468	hsa-miR-3196	PAR-CLIP	26701625
MIRT492468	hsa-miR-3196	PAR-CLIP	26701625
MIRT492465	hsa-miR-4488	PAR-CLIP	26701625
MIRT492464	hsa-miR-4697-5p	PAR-CLIP	26701625
MIRT492474	hsa-miR-4728-5p	PAR-CLIP	26701625
MIRT492474	hsa-miR-4728-5p	PAR-CLIP	26701625
MIRT492474	hsa-miR-4728-5p	PAR-CLIP	26701625
MIRT492474	hsa-miR-4728-5p	PAR-CLIP	26701625
MIRT492474	hsa-miR-4728-5p	PAR-CLIP	26701625
MIRT492473	hsa-miR-6785-5p	PAR-CLIP	26701625
MIRT492473	hsa-miR-6785-5p	PAR-CLIP	26701625
MIRT492473	hsa-miR-6785-5p	PAR-CLIP	26701625
MIRT492473	hsa-miR-6785-5p	PAR-CLIP	26701625
MIRT492473	hsa-miR-6785-5p	PAR-CLIP	26701625
MIRT492467	hsa-miR-6816-5p	PAR-CLIP	26701625
MIRT492467	hsa-miR-6816-5p	PAR-CLIP	26701625
MIRT492467	hsa-miR-6816-5p	PAR-CLIP	26701625
MIRT492467	hsa-miR-6816-5p	PAR-CLIP	26701625
MIRT492467	hsa-miR-6816-5p	PAR-CLIP	26701625
MIRT492471	hsa-miR-6883-5p	PAR-CLIP	26701625
MIRT492471	hsa-miR-6883-5p	PAR-CLIP	26701625
MIRT492471	hsa-miR-6883-5p	PAR-CLIP	26701625
MIRT492471	hsa-miR-6883-5p	PAR-CLIP	26701625
MIRT492471	hsa-miR-6883-5p	PAR-CLIP	26701625
MIRT492476	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT492475	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT492474	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT492473	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT492471	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT492472	hsa-miR-3175	PAR-CLIP	20371350
MIRT492470	hsa-miR-3180	PAR-CLIP	20371350
MIRT492469	hsa-miR-3180-3p	PAR-CLIP	20371350
MIRT492468	hsa-miR-3196	PAR-CLIP	20371350
MIRT492467	hsa-miR-6816-5p	PAR-CLIP	20371350
MIRT492466	hsa-miR-1237-5p	PAR-CLIP	20371350
MIRT492465	hsa-miR-4488	PAR-CLIP	20371350
MIRT492464	hsa-miR-4697-5p	PAR-CLIP	20371350
MIRT492476	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT492475	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT492474	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT492473	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT492471	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT492472	hsa-miR-3175	PAR-CLIP	20371350
MIRT492470	hsa-miR-3180	PAR-CLIP	20371350
MIRT492469	hsa-miR-3180-3p	PAR-CLIP	20371350
MIRT492468	hsa-miR-3196	PAR-CLIP	20371350
MIRT492467	hsa-miR-6816-5p	PAR-CLIP	20371350
MIRT492466	hsa-miR-1237-5p	PAR-CLIP	20371350
MIRT492465	hsa-miR-4488	PAR-CLIP	20371350
MIRT492464	hsa-miR-4697-5p	PAR-CLIP	20371350
MIRT492476	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT492475	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT492474	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT492473	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT492471	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT492472	hsa-miR-3175	PAR-CLIP	23592263
MIRT492470	hsa-miR-3180	PAR-CLIP	23592263
MIRT492469	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT492468	hsa-miR-3196	PAR-CLIP	23592263
MIRT492467	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT492466	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT492465	hsa-miR-4488	PAR-CLIP	23592263
MIRT492464	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT1292104	hsa-miR-106a	CLIP-seq
MIRT1292105	hsa-miR-106b	CLIP-seq
MIRT1292106	hsa-miR-130a	CLIP-seq
MIRT1292107	hsa-miR-130b	CLIP-seq
MIRT1292108	hsa-miR-17	CLIP-seq
MIRT1292109	hsa-miR-1908	CLIP-seq
MIRT1292110	hsa-miR-2052	CLIP-seq
MIRT1292111	hsa-miR-20a	CLIP-seq
MIRT1292112	hsa-miR-20b	CLIP-seq
MIRT1292113	hsa-miR-2113	CLIP-seq
MIRT1292114	hsa-miR-224	CLIP-seq
MIRT1292115	hsa-miR-2467-3p	CLIP-seq
MIRT1292116	hsa-miR-2467-5p	CLIP-seq
MIRT1292117	hsa-miR-301a	CLIP-seq
MIRT1292118	hsa-miR-301b	CLIP-seq
MIRT1292119	hsa-miR-30a	CLIP-seq
MIRT1292120	hsa-miR-30b	CLIP-seq
MIRT1292121	hsa-miR-30c	CLIP-seq
MIRT1292122	hsa-miR-30d	CLIP-seq
MIRT1292123	hsa-miR-30e	CLIP-seq
MIRT1292124	hsa-miR-3121-5p	CLIP-seq
MIRT1292125	hsa-miR-3122	CLIP-seq
MIRT1292126	hsa-miR-3609	CLIP-seq
MIRT1292127	hsa-miR-3614-5p	CLIP-seq
MIRT1292128	hsa-miR-3616-3p	CLIP-seq
MIRT1292129	hsa-miR-3666	CLIP-seq
MIRT1292130	hsa-miR-3689a-3p	CLIP-seq
MIRT1292131	hsa-miR-3689c	CLIP-seq
MIRT1292132	hsa-miR-3913-5p	CLIP-seq
MIRT1292133	hsa-miR-3960	CLIP-seq
MIRT1292134	hsa-miR-4283	CLIP-seq
MIRT1292135	hsa-miR-4295	CLIP-seq
MIRT1292136	hsa-miR-4326	CLIP-seq
MIRT1292137	hsa-miR-4436b-3p	CLIP-seq
MIRT1292138	hsa-miR-4495	CLIP-seq
MIRT1292139	hsa-miR-4508	CLIP-seq
MIRT1292140	hsa-miR-454	CLIP-seq
MIRT1292141	hsa-miR-4717-3p	CLIP-seq
MIRT1292142	hsa-miR-4796-3p	CLIP-seq
MIRT1292143	hsa-miR-514	CLIP-seq
MIRT1292144	hsa-miR-514b-3p	CLIP-seq
MIRT1292145	hsa-miR-519a	CLIP-seq
MIRT1292146	hsa-miR-519b-3p	CLIP-seq
MIRT1292147	hsa-miR-519c-3p	CLIP-seq
MIRT1292148	hsa-miR-519d	CLIP-seq
MIRT1292149	hsa-miR-548ah	CLIP-seq
MIRT1292150	hsa-miR-599	CLIP-seq
MIRT1292151	hsa-miR-663	CLIP-seq
MIRT1292152	hsa-miR-744	CLIP-seq
MIRT1292153	hsa-miR-93	CLIP-seq
MIRT1292104	hsa-miR-106a	CLIP-seq
MIRT1292105	hsa-miR-106b	CLIP-seq
MIRT1292106	hsa-miR-130a	CLIP-seq
MIRT1292107	hsa-miR-130b	CLIP-seq
MIRT1292108	hsa-miR-17	CLIP-seq
MIRT1292110	hsa-miR-2052	CLIP-seq
MIRT1292111	hsa-miR-20a	CLIP-seq
MIRT1292112	hsa-miR-20b	CLIP-seq
MIRT1292113	hsa-miR-2113	CLIP-seq
MIRT1292114	hsa-miR-224	CLIP-seq
MIRT1292117	hsa-miR-301a	CLIP-seq
MIRT1292118	hsa-miR-301b	CLIP-seq
MIRT1292119	hsa-miR-30a	CLIP-seq
MIRT1292120	hsa-miR-30b	CLIP-seq
MIRT1292121	hsa-miR-30c	CLIP-seq
MIRT1292122	hsa-miR-30d	CLIP-seq
MIRT1292123	hsa-miR-30e	CLIP-seq
MIRT1292124	hsa-miR-3121-5p	CLIP-seq
MIRT1292126	hsa-miR-3609	CLIP-seq
MIRT1292127	hsa-miR-3614-5p	CLIP-seq
MIRT1292129	hsa-miR-3666	CLIP-seq
MIRT1292154	hsa-miR-3944-5p	CLIP-seq
MIRT1292135	hsa-miR-4295	CLIP-seq
MIRT1292136	hsa-miR-4326	CLIP-seq
MIRT1292138	hsa-miR-4495	CLIP-seq
MIRT1292140	hsa-miR-454	CLIP-seq
MIRT1292141	hsa-miR-4717-3p	CLIP-seq
MIRT1292142	hsa-miR-4796-3p	CLIP-seq
MIRT1292143	hsa-miR-514	CLIP-seq
MIRT1292144	hsa-miR-514b-3p	CLIP-seq
MIRT1292145	hsa-miR-519a	CLIP-seq
MIRT1292146	hsa-miR-519b-3p	CLIP-seq
MIRT1292147	hsa-miR-519c-3p	CLIP-seq
MIRT1292148	hsa-miR-519d	CLIP-seq
MIRT1292149	hsa-miR-548ah	CLIP-seq
MIRT1292150	hsa-miR-599	CLIP-seq
MIRT1292153	hsa-miR-93	CLIP-seq
MIRT1292113	hsa-miR-2113	CLIP-seq
MIRT1292150	hsa-miR-599	CLIP-seq
MIRT1292110	hsa-miR-2052	CLIP-seq
MIRT1292113	hsa-miR-2113	CLIP-seq
MIRT1292124	hsa-miR-3121-5p	CLIP-seq
MIRT1292154	hsa-miR-3944-5p	CLIP-seq
MIRT1292136	hsa-miR-4326	CLIP-seq
MIRT1292150	hsa-miR-599	CLIP-seq
MIRT1292104	hsa-miR-106a	CLIP-seq
MIRT1292105	hsa-miR-106b	CLIP-seq
MIRT1292106	hsa-miR-130a	CLIP-seq
MIRT1292107	hsa-miR-130b	CLIP-seq
MIRT1292108	hsa-miR-17	CLIP-seq
MIRT1292110	hsa-miR-2052	CLIP-seq
MIRT1292111	hsa-miR-20a	CLIP-seq
MIRT1292112	hsa-miR-20b	CLIP-seq
MIRT1292117	hsa-miR-301a	CLIP-seq
MIRT1292118	hsa-miR-301b	CLIP-seq
MIRT2439844	hsa-miR-3120-3p	CLIP-seq
MIRT1292126	hsa-miR-3609	CLIP-seq
MIRT2439845	hsa-miR-365	CLIP-seq
MIRT1292129	hsa-miR-3666	CLIP-seq
MIRT1292135	hsa-miR-4295	CLIP-seq
MIRT1292140	hsa-miR-454	CLIP-seq
MIRT2439846	hsa-miR-4725-5p	CLIP-seq
MIRT1292142	hsa-miR-4796-3p	CLIP-seq
MIRT2439847	hsa-miR-504	CLIP-seq
MIRT1292145	hsa-miR-519a	CLIP-seq
MIRT1292146	hsa-miR-519b-3p	CLIP-seq
MIRT1292147	hsa-miR-519c-3p	CLIP-seq
MIRT1292148	hsa-miR-519d	CLIP-seq
MIRT1292149	hsa-miR-548ah	CLIP-seq
MIRT1292153	hsa-miR-93	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS	10471929
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005525	Function	GTP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	TAS	10471929, 10673050
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10840027
GO:0007263	Process	Nitric oxide mediated signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0016529	Component	Sarcoplasmic reticulum	IEA
GO:0031681	Function	G-protein beta-subunit binding	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA

MIM	HGNC	e!Ensembl
605550	15828	ENSG00000108551

Q9Y272

Protein name

Dexamethasone-induced Ras-related protein 1 (Activator of G-protein signaling 1)

Protein function

Small GTPase. Negatively regulates the transcription regulation activity of the APBB1/FE65-APP complex via its interaction with APBB1/FE65 (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	26 → 196	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a variety of tissues including heart, cardiovascular tissues, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, gastrointestinal and reproductive tissues. {ECO:0000269|PubMed:10673050, ECO:0000269|PubMed:128

Sequence

MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDF
HRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQ
ILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKK
NSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGGDPG
DAFGIVAPFARRPSVHSDLMYIREKASAGSQAKDKERCVIS

Sequence length

281

Interactions

View interactions

	KEGG
	Circadian entrainment Cushing syndrome

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (42)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	10827106, 15908569, 16845398, 17357087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	28600528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29858554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	36012391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	28600528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	36130474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22644676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33255991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	38006610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30064475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	29270391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10611312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10611312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	8712800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28281975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28281975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28600528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	35896115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	36130474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	31184707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	27459931	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36951484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	8112600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	8112600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22644676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26535714, 28979693, 29659486, 8112600		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31484460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19549772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31406150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15833841, 20978187, 25374067, 28600528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27613758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25374067, 26535714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	31406150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22292074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	27459931	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Potocki-Lupski syndrome	Potocki-Lupski Syndrome	BEFREE	23703963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	30925311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37565899	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Smith-Magenis syndrome	Smith-Magenis Syndrome	BEFREE	23703963, 29077507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26159854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RASD1 (ras related dexamethasone induced 1)