Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51650
Gene name	Mitochondrial ribosomal protein S33
Gene symbol	MRPS33
Synonyms (NCBI Gene)	CGI-139MRP-S33PTD003S33mtmS33
Chromosome	7
Chromosome location	7q34
Summary	Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Show/Hide all (63)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001614	hsa-let-7b-5p	pSILAC	18668040
MIRT001614	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT048601	hsa-miR-99a-5p	CLASH	23622248
MIRT048411	hsa-miR-100-5p	CLASH	23622248
MIRT2046078	hsa-miR-3915	CLIP-seq
MIRT2046079	hsa-miR-3928	CLIP-seq
MIRT2046080	hsa-miR-4252	CLIP-seq
MIRT2046081	hsa-miR-4659a-3p	CLIP-seq
MIRT2046082	hsa-miR-4659b-3p	CLIP-seq
MIRT2046083	hsa-miR-4691-5p	CLIP-seq
MIRT2046084	hsa-miR-4768-5p	CLIP-seq
MIRT2046085	hsa-miR-942	CLIP-seq
MIRT2574150	hsa-miR-143	CLIP-seq
MIRT2574151	hsa-miR-197	CLIP-seq
MIRT2574152	hsa-miR-3126-5p	CLIP-seq
MIRT2574153	hsa-miR-323b-3p	CLIP-seq
MIRT2046078	hsa-miR-3915	CLIP-seq
MIRT2046079	hsa-miR-3928	CLIP-seq
MIRT2574154	hsa-miR-3978	CLIP-seq
MIRT2046080	hsa-miR-4252	CLIP-seq
MIRT2574155	hsa-miR-4287	CLIP-seq
MIRT2574156	hsa-miR-4325	CLIP-seq
MIRT2574157	hsa-miR-4326	CLIP-seq
MIRT2574158	hsa-miR-4419a	CLIP-seq
MIRT2574159	hsa-miR-4428	CLIP-seq
MIRT2574160	hsa-miR-4469	CLIP-seq
MIRT2574161	hsa-miR-4476	CLIP-seq
MIRT2574162	hsa-miR-4510	CLIP-seq
MIRT2046081	hsa-miR-4659a-3p	CLIP-seq
MIRT2046082	hsa-miR-4659b-3p	CLIP-seq
MIRT2574163	hsa-miR-4685-3p	CLIP-seq
MIRT2046083	hsa-miR-4691-5p	CLIP-seq
MIRT2574164	hsa-miR-4729	CLIP-seq
MIRT2574165	hsa-miR-4760-5p	CLIP-seq
MIRT2046084	hsa-miR-4768-5p	CLIP-seq
MIRT2574166	hsa-miR-4770	CLIP-seq
MIRT2574167	hsa-miR-5096	CLIP-seq
MIRT2574168	hsa-miR-526b	CLIP-seq
MIRT2574169	hsa-miR-579	CLIP-seq
MIRT2574170	hsa-miR-642a	CLIP-seq
MIRT2574171	hsa-miR-651	CLIP-seq
MIRT2574172	hsa-miR-892a	CLIP-seq
MIRT2046085	hsa-miR-942	CLIP-seq
MIRT2574173	hsa-miR-943	CLIP-seq
MIRT2574152	hsa-miR-3126-5p	CLIP-seq
MIRT2574153	hsa-miR-323b-3p	CLIP-seq
MIRT2046078	hsa-miR-3915	CLIP-seq
MIRT2046079	hsa-miR-3928	CLIP-seq
MIRT2574154	hsa-miR-3978	CLIP-seq
MIRT2046080	hsa-miR-4252	CLIP-seq
MIRT2574155	hsa-miR-4287	CLIP-seq
MIRT2574156	hsa-miR-4325	CLIP-seq
MIRT2574158	hsa-miR-4419a	CLIP-seq
MIRT2574160	hsa-miR-4469	CLIP-seq
MIRT2574162	hsa-miR-4510	CLIP-seq
MIRT2046081	hsa-miR-4659a-3p	CLIP-seq
MIRT2046082	hsa-miR-4659b-3p	CLIP-seq
MIRT2574163	hsa-miR-4685-3p	CLIP-seq
MIRT2046083	hsa-miR-4691-5p	CLIP-seq
MIRT2046084	hsa-miR-4768-5p	CLIP-seq
MIRT2574168	hsa-miR-526b	CLIP-seq
MIRT2574170	hsa-miR-642a	CLIP-seq
MIRT2046085	hsa-miR-942	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003735	Function	Structural constituent of ribosome	NAS	11279123
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005763	Component	Mitochondrial small ribosomal subunit	NAS	11279123, 25838379
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	NAS	11279123
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
611993	16634	ENSG00000090263

Q9Y291

Protein name

Small ribosomal subunit protein mS33 (28S ribosomal protein S33, mitochondrial) (MRP-S33) (S33mt)

PDB

3J9M , 6NU2 , 6NU3 , 6RW4 , 6RW5 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5I , 7A5K , 7L08 , 7OG4 , 7P2E , 7PNX , 7PNY , 7PNZ , 7PO0 , 7PO1 , 7PO2 , 7PO3 , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8CSP , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU , 8K2A , 8OIR , 8OIS , 8QRK , 8QRL , 8QRM , 8QRN , 8RRI , 8XT0 , 8XT2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08293	MRP-S33	6 → 96	Mitochondrial ribosomal subunit S27	Family

Sequence

MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAE
LMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKRK

Sequence length

106

Interactions

View interactions

	Reactome
			Mitochondrial translation elongation Mitochondrial translation termination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Manic	Manic Disorder	CTD_human_DG	31043756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	31043756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	34446064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MRPS33 (mitochondrial ribosomal protein S33)