Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51649
Gene name	Mitochondrial ribosomal protein S23
Gene symbol	MRPS23
Synonyms (NCBI Gene)	CGI-138COXPD46HSPC329MRP-S23mS23
Chromosome	17
Chromosome location	17q22
Summary	Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

165

Show/Hide all (165)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031963	hsa-miR-16-5p	Proteomics	18668040
MIRT047269	hsa-miR-181b-5p	CLASH	23622248
MIRT041099	hsa-miR-503-5p	CLASH	23622248
MIRT040709	hsa-miR-92b-3p	CLASH	23622248
MIRT473005	hsa-miR-5586-3p	PAR-CLIP	20371350
MIRT473004	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT473003	hsa-miR-575	PAR-CLIP	20371350
MIRT473002	hsa-miR-3174	PAR-CLIP	20371350
MIRT473001	hsa-miR-4691-3p	PAR-CLIP	20371350
MIRT472999	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT472998	hsa-miR-3194-5p	PAR-CLIP	20371350
MIRT472996	hsa-miR-1257	PAR-CLIP	20371350
MIRT472995	hsa-miR-3157-5p	PAR-CLIP	20371350
MIRT472994	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT472993	hsa-miR-1202	PAR-CLIP	20371350
MIRT472992	hsa-miR-3972	PAR-CLIP	20371350
MIRT472991	hsa-miR-6831-5p	PAR-CLIP	20371350
MIRT473005	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT473004	hsa-miR-4676-5p	PAR-CLIP	23592263
MIRT473003	hsa-miR-575	PAR-CLIP	23592263
MIRT473002	hsa-miR-3174	PAR-CLIP	23592263
MIRT473001	hsa-miR-4691-3p	PAR-CLIP	23592263
MIRT473000	hsa-miR-338-3p	PAR-CLIP	23592263
MIRT472999	hsa-miR-574-5p	PAR-CLIP	23592263
MIRT472997	hsa-miR-5689	PAR-CLIP	23592263
MIRT472998	hsa-miR-3194-5p	PAR-CLIP	23592263
MIRT472996	hsa-miR-1257	PAR-CLIP	23592263
MIRT472995	hsa-miR-3157-5p	PAR-CLIP	23592263
MIRT472994	hsa-miR-6869-5p	PAR-CLIP	23592263
MIRT472993	hsa-miR-1202	PAR-CLIP	23592263
MIRT472992	hsa-miR-3972	PAR-CLIP	23592263
MIRT472991	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT473005	hsa-miR-5586-3p	PAR-CLIP	20371350
MIRT473004	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT473003	hsa-miR-575	PAR-CLIP	20371350
MIRT473002	hsa-miR-3174	PAR-CLIP	20371350
MIRT473001	hsa-miR-4691-3p	PAR-CLIP	20371350
MIRT472999	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT472998	hsa-miR-3194-5p	PAR-CLIP	20371350
MIRT472996	hsa-miR-1257	PAR-CLIP	20371350
MIRT472995	hsa-miR-3157-5p	PAR-CLIP	20371350
MIRT472994	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT472993	hsa-miR-1202	PAR-CLIP	20371350
MIRT472992	hsa-miR-3972	PAR-CLIP	20371350
MIRT472991	hsa-miR-6831-5p	PAR-CLIP	20371350
MIRT473005	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT473004	hsa-miR-4676-5p	PAR-CLIP	23592263
MIRT473003	hsa-miR-575	PAR-CLIP	23592263
MIRT473002	hsa-miR-3174	PAR-CLIP	23592263
MIRT473001	hsa-miR-4691-3p	PAR-CLIP	23592263
MIRT473000	hsa-miR-338-3p	PAR-CLIP	23592263
MIRT472999	hsa-miR-574-5p	PAR-CLIP	23592263
MIRT472997	hsa-miR-5689	PAR-CLIP	23592263
MIRT472998	hsa-miR-3194-5p	PAR-CLIP	23592263
MIRT472996	hsa-miR-1257	PAR-CLIP	23592263
MIRT472995	hsa-miR-3157-5p	PAR-CLIP	23592263
MIRT472994	hsa-miR-6869-5p	PAR-CLIP	23592263
MIRT472993	hsa-miR-1202	PAR-CLIP	23592263
MIRT472992	hsa-miR-3972	PAR-CLIP	23592263
MIRT472991	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT1160026	hsa-miR-1207-5p	CLIP-seq
MIRT1160027	hsa-miR-1303	CLIP-seq
MIRT1160028	hsa-miR-181a	CLIP-seq
MIRT1160029	hsa-miR-181b	CLIP-seq
MIRT1160030	hsa-miR-181c	CLIP-seq
MIRT1160031	hsa-miR-181d	CLIP-seq
MIRT1160032	hsa-miR-2110	CLIP-seq
MIRT1160033	hsa-miR-3129-3p	CLIP-seq
MIRT1160034	hsa-miR-3161	CLIP-seq
MIRT1160035	hsa-miR-369-3p	CLIP-seq
MIRT1160036	hsa-miR-3714	CLIP-seq
MIRT1160037	hsa-miR-3908	CLIP-seq
MIRT1160038	hsa-miR-3941	CLIP-seq
MIRT1160039	hsa-miR-3973	CLIP-seq
MIRT1160040	hsa-miR-4262	CLIP-seq
MIRT1160041	hsa-miR-4271	CLIP-seq
MIRT1160042	hsa-miR-4470	CLIP-seq
MIRT1160043	hsa-miR-4476	CLIP-seq
MIRT1160044	hsa-miR-452	CLIP-seq
MIRT1160045	hsa-miR-4639-3p	CLIP-seq
MIRT1160046	hsa-miR-466	CLIP-seq
MIRT1160047	hsa-miR-4667-5p	CLIP-seq
MIRT1160048	hsa-miR-4672	CLIP-seq
MIRT1160049	hsa-miR-4676-3p	CLIP-seq
MIRT1160050	hsa-miR-4699-3p	CLIP-seq
MIRT1160051	hsa-miR-4700-5p	CLIP-seq
MIRT1160052	hsa-miR-4725-3p	CLIP-seq
MIRT1160053	hsa-miR-4763-3p	CLIP-seq
MIRT1160054	hsa-miR-4803	CLIP-seq
MIRT1160055	hsa-miR-494	CLIP-seq
MIRT1160056	hsa-miR-513a-3p	CLIP-seq
MIRT1160057	hsa-miR-520g	CLIP-seq
MIRT1160058	hsa-miR-520h	CLIP-seq
MIRT1160059	hsa-miR-543	CLIP-seq
MIRT1160060	hsa-miR-545	CLIP-seq
MIRT1160061	hsa-miR-548a-5p	CLIP-seq
MIRT1160062	hsa-miR-548aa	CLIP-seq
MIRT1160063	hsa-miR-548ab	CLIP-seq
MIRT1160064	hsa-miR-548ak	CLIP-seq
MIRT1160065	hsa-miR-548b-5p	CLIP-seq
MIRT1160066	hsa-miR-548c-3p	CLIP-seq
MIRT1160067	hsa-miR-548c-5p	CLIP-seq
MIRT1160068	hsa-miR-548d-5p	CLIP-seq
MIRT1160069	hsa-miR-548h	CLIP-seq
MIRT1160070	hsa-miR-548i	CLIP-seq
MIRT1160071	hsa-miR-548j	CLIP-seq
MIRT1160072	hsa-miR-548w	CLIP-seq
MIRT1160073	hsa-miR-548y	CLIP-seq
MIRT1160074	hsa-miR-559	CLIP-seq
MIRT1160075	hsa-miR-646	CLIP-seq
MIRT1160076	hsa-miR-940	CLIP-seq
MIRT2045972	hsa-miR-1912	CLIP-seq
MIRT2045973	hsa-miR-23a	CLIP-seq
MIRT2045974	hsa-miR-23b	CLIP-seq
MIRT2045975	hsa-miR-23c	CLIP-seq
MIRT1160033	hsa-miR-3129-3p	CLIP-seq
MIRT2045976	hsa-miR-3182	CLIP-seq
MIRT1160035	hsa-miR-369-3p	CLIP-seq
MIRT1160038	hsa-miR-3941	CLIP-seq
MIRT1160042	hsa-miR-4470	CLIP-seq
MIRT2045977	hsa-miR-4504	CLIP-seq
MIRT1160046	hsa-miR-466	CLIP-seq
MIRT1160048	hsa-miR-4672	CLIP-seq
MIRT1160050	hsa-miR-4699-3p	CLIP-seq
MIRT1160054	hsa-miR-4803	CLIP-seq
MIRT2045978	hsa-miR-542-3p	CLIP-seq
MIRT2045979	hsa-miR-548n	CLIP-seq
MIRT2045980	hsa-miR-548t	CLIP-seq
MIRT2045981	hsa-miR-549	CLIP-seq
MIRT2045982	hsa-miR-676	CLIP-seq
MIRT2045983	hsa-miR-758	CLIP-seq
MIRT2275049	hsa-miR-1321	CLIP-seq
MIRT2275050	hsa-miR-144	CLIP-seq
MIRT1160028	hsa-miR-181a	CLIP-seq
MIRT1160029	hsa-miR-181b	CLIP-seq
MIRT1160030	hsa-miR-181c	CLIP-seq
MIRT1160031	hsa-miR-181d	CLIP-seq
MIRT2275051	hsa-miR-1827	CLIP-seq
MIRT2045973	hsa-miR-23a	CLIP-seq
MIRT2045974	hsa-miR-23b	CLIP-seq
MIRT2045975	hsa-miR-23c	CLIP-seq
MIRT2275052	hsa-miR-3165	CLIP-seq
MIRT2045976	hsa-miR-3182	CLIP-seq
MIRT2275053	hsa-miR-3612	CLIP-seq
MIRT2275054	hsa-miR-3665	CLIP-seq
MIRT2275055	hsa-miR-3691-5p	CLIP-seq
MIRT2275056	hsa-miR-3944-5p	CLIP-seq
MIRT1160040	hsa-miR-4262	CLIP-seq
MIRT2275057	hsa-miR-4270	CLIP-seq
MIRT2275058	hsa-miR-4441	CLIP-seq
MIRT2275059	hsa-miR-4650-5p	CLIP-seq
MIRT1160048	hsa-miR-4672	CLIP-seq
MIRT1160050	hsa-miR-4699-3p	CLIP-seq
MIRT2275060	hsa-miR-4724-5p	CLIP-seq
MIRT2275061	hsa-miR-4736	CLIP-seq
MIRT2275062	hsa-miR-4739	CLIP-seq
MIRT2275063	hsa-miR-4756-5p	CLIP-seq
MIRT1160054	hsa-miR-4803	CLIP-seq
MIRT1160059	hsa-miR-543	CLIP-seq
MIRT1160066	hsa-miR-548c-3p	CLIP-seq
MIRT2045979	hsa-miR-548n	CLIP-seq
MIRT2045980	hsa-miR-548t	CLIP-seq
MIRT2045981	hsa-miR-549	CLIP-seq
MIRT2275064	hsa-miR-650	CLIP-seq
MIRT1160076	hsa-miR-940	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0005515	Function	Protein binding	IPI	24965446, 25416956, 32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005763	Component	Mitochondrial small ribosomal subunit	NAS	25838379
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
611985	14509	ENSG00000181610

Q9Y3D9

Protein name

Small ribosomal subunit protein mS23 (28S ribosomal protein S23, mitochondrial) (MRP-S23) (S23mt)

PDB

3J9M , 6NU2 , 6NU3 , 6RW4 , 6RW5 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5I , 7A5K , 7L08 , 7OG4 , 7P2E , 7PNX , 7PNY , 7PNZ , 7PO0 , 7PO1 , 7PO2 , 7PO3 , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8CSP , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU , 8K2A , 8OIR , 8OIS , 8QRK , 8QRL , 8QRM , 8QRN , 8RRI , 8XT0 , 8XT2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10484	MRP-S23	2 → 130	Mitochondrial ribosomal protein S23	Family

Sequence

MAGSRLETVGSIFSRTRDLVRAGVLKEKPLWFDVYDAFPPLREPVFQRPRVRYGKAKAPI
QDIWYHEDRIRAKFYSVYGSGQRAFDLFNPNFKSTCQRFVEKYTELQKLGETDEEKLFVE
TGKALLAEGVILRRVGEARTQHGGSHVSRKSEHLSVRPQTALEENETQKEVPQDQHLEAP
ADQSKGLLPP

Sequence length

190

Interactions

View interactions

	Reactome
			Mitochondrial translation elongation Mitochondrial translation termination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Combined oxidative phosphorylation deficiency 46	Pathogenic	rs772721937	RCV001250729	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTIPHOSPHOLIPID SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MRPS23-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acidosis Lactic	Lactic acidosis	Pubtator	38086984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	25151356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29069745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25151356, 31950385	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28714366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32828126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	38086984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	38086984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28714366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	38086984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	25151356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29069745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28714366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	25151356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	25151356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	25151356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	26741492	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	38086984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17054779, 28714366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17054779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MRPS23 (mitochondrial ribosomal protein S23)