Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51635
Gene name	Dehydrogenase/reductase 7
Gene symbol	DHRS7
Synonyms (NCBI Gene)	CGI-86SDR34C1retDSR4retSDR4
Chromosome	14
Chromosome location	14q23.1
Summary	This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46,000 members. Members in this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids a

Show/Hide all (47)

miRTarBase ID	miRNA	Experiments
MIRT935006	hsa-miR-1470	CLIP-seq
MIRT935007	hsa-miR-1825	CLIP-seq
MIRT935008	hsa-miR-199a-5p	CLIP-seq
MIRT935009	hsa-miR-199b-5p	CLIP-seq
MIRT935010	hsa-miR-3653	CLIP-seq
MIRT935011	hsa-miR-3925-3p	CLIP-seq
MIRT935012	hsa-miR-4287	CLIP-seq
MIRT935013	hsa-miR-4307	CLIP-seq
MIRT935014	hsa-miR-4469	CLIP-seq
MIRT935015	hsa-miR-4667-3p	CLIP-seq
MIRT935016	hsa-miR-4668-3p	CLIP-seq
MIRT935017	hsa-miR-4685-3p	CLIP-seq
MIRT935018	hsa-miR-4699-5p	CLIP-seq
MIRT935019	hsa-miR-4713-5p	CLIP-seq
MIRT935020	hsa-miR-4719	CLIP-seq
MIRT935021	hsa-miR-4781-3p	CLIP-seq
MIRT935022	hsa-miR-4795-3p	CLIP-seq
MIRT935023	hsa-miR-548a-5p	CLIP-seq
MIRT935024	hsa-miR-548ab	CLIP-seq
MIRT935025	hsa-miR-548ak	CLIP-seq
MIRT935026	hsa-miR-548b-5p	CLIP-seq
MIRT935027	hsa-miR-548c-5p	CLIP-seq
MIRT935028	hsa-miR-548d-5p	CLIP-seq
MIRT935029	hsa-miR-548h	CLIP-seq
MIRT935030	hsa-miR-548i	CLIP-seq
MIRT935031	hsa-miR-548j	CLIP-seq
MIRT935032	hsa-miR-548n	CLIP-seq
MIRT935033	hsa-miR-548w	CLIP-seq
MIRT935034	hsa-miR-548y	CLIP-seq
MIRT935035	hsa-miR-559	CLIP-seq
MIRT935036	hsa-miR-587	CLIP-seq
MIRT935037	hsa-miR-671-5p	CLIP-seq
MIRT935006	hsa-miR-1470	CLIP-seq
MIRT935007	hsa-miR-1825	CLIP-seq
MIRT935008	hsa-miR-199a-5p	CLIP-seq
MIRT935009	hsa-miR-199b-5p	CLIP-seq
MIRT935011	hsa-miR-3925-3p	CLIP-seq
MIRT935012	hsa-miR-4287	CLIP-seq
MIRT935013	hsa-miR-4307	CLIP-seq
MIRT935014	hsa-miR-4469	CLIP-seq
MIRT935015	hsa-miR-4667-3p	CLIP-seq
MIRT935017	hsa-miR-4685-3p	CLIP-seq
MIRT935019	hsa-miR-4713-5p	CLIP-seq
MIRT1976886	hsa-miR-548k	CLIP-seq
MIRT935032	hsa-miR-548n	CLIP-seq
MIRT1976887	hsa-miR-552	CLIP-seq
MIRT935036	hsa-miR-587	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004090	Function	Carbonyl reductase (NADPH) activity	IDA	24246760, 26466768, 28457967, 28687384
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	24246760, 28457967
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IDA	24246760, 26466768, 28457967, 28687384
GO:0042572	Process	Retinol metabolic process	IEA
GO:0052650	Function	All-trans-retinol dehydrogenase (NADP+) activity	IDA	26466768
GO:0052650	Function	All-trans-retinol dehydrogenase (NADP+) activity	IEA

MIM	HGNC	e!Ensembl
612833	21524	ENSG00000100612

Q9Y394

Protein name

Dehydrogenase/reductase SDR family member 7 (EC 1.1.1.-) (Retinal short-chain dehydrogenase/reductase 4) (retSDR4) (Short chain dehydrogenase/reductase family 34C member 1) (Protein SDR34C1)

Protein function

NADPH-dependent oxidoreductase which catalyzes the reduction of a variety of compounds bearing carbonyl groups including steroids, retinoids and xenobiotics (PubMed:24246760, PubMed:26466768, PubMed:28457967, PubMed:28687384). Catalyzes the redu

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00106	adh_short	51 → 250	short chain dehydrogenase	Domain

Tissue specificity

TISSUE SPECIFICITY: Found predominantly in the adrenal glands, liver, thyroid, prostate, small intestine, colon, stomach, kidney and brain (PubMed:26466768). Lower levels observed in skeletal muscle, the lung and the spleen (PubMed:26466768). {ECO:0000269

Sequence

MNWELLLWLLVLCALLLLLVQLLRFLRADGDLTLLWAEWQGRRPEWELTDMVVWVTGASS
GIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEA
ATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIER
KQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSN
IVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTYLWQY
MPTWAWWITNKMGKKRIENFKSGVDADSSYFKIFKTKHD

Sequence length

339

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Fatty Liver	Fatty Liver	CTD_human_DG	25226513		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26311046, 28457967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26311046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26311046, 28457967		★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	26311046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26311046, 28457967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26311046, 38201261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	25226513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34773716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DHRS7 (dehydrogenase/reductase 7)