Gene Gene information from NCBI Gene database.
Entrez ID 51616
Gene name TATA-box binding protein associated factor 9b
Gene symbol TAF9B
Synonyms (NCBI Gene)
DN-7DN7TAF9LTAFII31LTFIID-31
Chromosome X
Chromosome location Xq21.1
Summary Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly,
miRNA miRNA information provided by mirtarbase database.
419
miRTarBase ID miRNA Experiments Reference
MIRT001587 hsa-let-7b-5p pSILAC 18668040
MIRT024725 hsa-miR-215-5p Microarray 19074876
MIRT026846 hsa-miR-192-5p Microarray 19074876
MIRT030171 hsa-miR-26b-5p Microarray 19088304
MIRT001587 hsa-let-7b-5p Proteomics;Other 18668040
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 12837753
GO:0003714 Function Transcription corepressor activity IC 12837753
GO:0005515 Function Protein binding IPI 15899866, 16189514, 25416956, 28514442, 31511497, 32296183, 33961781
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300754 17306 ENSG00000187325
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HBM6
Protein name Transcription initiation factor TFIID subunit 9B (Neuronal cell death-related protein 7) (DN-7) (Transcription initiation factor TFIID subunit 9-like) (Transcription-associated factor TAFII31L)
Protein function Essential for cell viability. TAF9 and TAF9B are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes. May have a role in gene regulation associated with apoptosis. TAFs are components of the tra
PDB 7KTR , 7KTS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02291 TFIID-31kDa 9 130 Transcription initiation factor IID, 31kD subunit Domain
Sequence
MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSH
AKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRY
CLTAPNYRLK
SLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTS
QRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKR
KHEDDDDNDIM
Sequence length 251
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Basal transcription factors   Ub-specific processing proteases
RNA Polymerase II Pre-transcription Events
Regulation of TP53 Activity through Phosphorylation
RNA Polymerase II Promoter Escape
RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
RNA Polymerase II Transcription Initiation
RNA Polymerase II Transcription Initiation And Promoter Clearance
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
GRAVES DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Intellectual disability Uncertain significance ClinVar
Disgenet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)