Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51614
Gene name	ERGIC and golgi 3
Gene symbol	ERGIC3
Synonyms (NCBI Gene)	C20orf47C2orf47CGI-54Erv46NY-BR-84PRO0989SDBCAG84dJ477O4.2
Chromosome	20
Chromosome location	20q11.22

Show/Hide all (62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007115	hsa-miR-490-3p	GFP reporter assay	23212913
MIRT007115	hsa-miR-490-3p	GFP reporter assay	23212913
MIRT032333	hsa-let-7b-5p	Proteomics	18668040
MIRT968941	hsa-miR-1275	CLIP-seq
MIRT968942	hsa-miR-140-3p	CLIP-seq
MIRT968943	hsa-miR-151-5p	CLIP-seq
MIRT968944	hsa-miR-151b	CLIP-seq
MIRT968945	hsa-miR-1972	CLIP-seq
MIRT968946	hsa-miR-2467-3p	CLIP-seq
MIRT968947	hsa-miR-3689d	CLIP-seq
MIRT968948	hsa-miR-4270	CLIP-seq
MIRT968949	hsa-miR-4441	CLIP-seq
MIRT968950	hsa-miR-4505	CLIP-seq
MIRT968951	hsa-miR-4525	CLIP-seq
MIRT968952	hsa-miR-4656	CLIP-seq
MIRT968953	hsa-miR-4665-5p	CLIP-seq
MIRT968954	hsa-miR-4723-5p	CLIP-seq
MIRT968955	hsa-miR-4731-5p	CLIP-seq
MIRT968956	hsa-miR-485-5p	CLIP-seq
MIRT968957	hsa-miR-625	CLIP-seq
MIRT968958	hsa-miR-637	CLIP-seq
MIRT968941	hsa-miR-1275	CLIP-seq
MIRT968942	hsa-miR-140-3p	CLIP-seq
MIRT968943	hsa-miR-151-5p	CLIP-seq
MIRT968944	hsa-miR-151b	CLIP-seq
MIRT968945	hsa-miR-1972	CLIP-seq
MIRT968946	hsa-miR-2467-3p	CLIP-seq
MIRT968959	hsa-miR-3125	CLIP-seq
MIRT968960	hsa-miR-3150b-3p	CLIP-seq
MIRT968947	hsa-miR-3689d	CLIP-seq
MIRT968961	hsa-miR-3916	CLIP-seq
MIRT968948	hsa-miR-4270	CLIP-seq
MIRT968962	hsa-miR-4283	CLIP-seq
MIRT968949	hsa-miR-4441	CLIP-seq
MIRT968963	hsa-miR-4489	CLIP-seq
MIRT968964	hsa-miR-4492	CLIP-seq
MIRT968965	hsa-miR-4498	CLIP-seq
MIRT968950	hsa-miR-4505	CLIP-seq
MIRT968951	hsa-miR-4525	CLIP-seq
MIRT968952	hsa-miR-4656	CLIP-seq
MIRT968953	hsa-miR-4665-5p	CLIP-seq
MIRT968966	hsa-miR-4705	CLIP-seq
MIRT968967	hsa-miR-4714-3p	CLIP-seq
MIRT968954	hsa-miR-4723-5p	CLIP-seq
MIRT968955	hsa-miR-4731-5p	CLIP-seq
MIRT968968	hsa-miR-4784	CLIP-seq
MIRT968956	hsa-miR-485-5p	CLIP-seq
MIRT968969	hsa-miR-583	CLIP-seq
MIRT968957	hsa-miR-625	CLIP-seq
MIRT968958	hsa-miR-637	CLIP-seq
MIRT968970	hsa-miR-762	CLIP-seq
MIRT968948	hsa-miR-4270	CLIP-seq
MIRT968949	hsa-miR-4441	CLIP-seq
MIRT968969	hsa-miR-583	CLIP-seq
MIRT968962	hsa-miR-4283	CLIP-seq
MIRT968963	hsa-miR-4489	CLIP-seq
MIRT968964	hsa-miR-4492	CLIP-seq
MIRT968965	hsa-miR-4498	CLIP-seq
MIRT968950	hsa-miR-4505	CLIP-seq
MIRT968967	hsa-miR-4714-3p	CLIP-seq
MIRT968955	hsa-miR-4731-5p	CLIP-seq
MIRT968970	hsa-miR-762	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IBA
GO:0005515	Function	Protein binding	IPI	15308636, 31142615, 32296183, 33961781
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IBA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IDA	31142615
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	NAS	31142615
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030134	Component	COPII-coated ER to Golgi transport vesicle	IBA
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IEA
GO:0061852	Component	Retrograde transporter complex, Golgi to ER	IPI	31142615
GO:0090316	Process	Positive regulation of intracellular protein transport	IMP	31142615
GO:1990351	Component	Transporter complex	IPI	31142615

MIM	HGNC	e!Ensembl
616971	15927	ENSG00000125991

Q9Y282

Protein name

Endoplasmic reticulum-Golgi intermediate compartment protein 3 (Serologically defined breast cancer antigen NY-BR-84)

Protein function

Possible role in transport between endoplasmic reticulum and Golgi. Positively regulates trafficking of the secretory proteins SERPINA1/alpha1-antitrypsin and HP/haptoglobin (PubMed:31142615).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13850	ERGIC_N	7 → 97	Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC)	Domain
PF07970	COPIIcoated_ERV	145 → 363	Endoplasmic reticulum vesicle transporter	Family

Sequence

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV
DKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAE
RHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIE
QCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNI
NMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQF
SVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAG
LIDSLIYHSARAIQKKIDLGKTT

Sequence length

383

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Developmental disorder	Likely pathogenic	rs2515204602	RCV003441161	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DISABILITIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23374247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23212913, 35602902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23374247, 26177443, 27588471, 31530266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23374247, 26177443	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	27588471		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of lung	Lung Cancer	BEFREE	23374247, 26177443, 27588471, 31530266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	27588471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26177443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26177443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	27588471		★★★★★ ★☆☆☆☆ Found in Text Mining only

ERGIC3 (ERGIC and golgi 3)