Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51608
Gene name	Guided entry of tail-anchored proteins factor 4
Gene symbol	GET4
Synonyms (NCBI Gene)	C7orf20CDG2YCEECGI-20TRC35
Chromosome	7
Chromosome location	7p22.3

114

Show/Hide all (114)

miRTarBase ID	miRNA	Experiments	Reference
MIRT691274	hsa-miR-1265	HITS-CLIP	23313552
MIRT691273	hsa-miR-4258	HITS-CLIP	23313552
MIRT691272	hsa-miR-7108-3p	HITS-CLIP	23313552
MIRT691271	hsa-miR-1470	HITS-CLIP	23313552
MIRT691270	hsa-miR-4667-3p	HITS-CLIP	23313552
MIRT691269	hsa-miR-1185-5p	HITS-CLIP	23313552
MIRT691268	hsa-miR-3679-5p	HITS-CLIP	23313552
MIRT691267	hsa-miR-3605-5p	HITS-CLIP	23313552
MIRT691266	hsa-miR-4764-5p	HITS-CLIP	23313552
MIRT691274	hsa-miR-1265	HITS-CLIP	23313552
MIRT691273	hsa-miR-4258	HITS-CLIP	23313552
MIRT691272	hsa-miR-7108-3p	HITS-CLIP	23313552
MIRT691271	hsa-miR-1470	HITS-CLIP	23313552
MIRT691270	hsa-miR-4667-3p	HITS-CLIP	23313552
MIRT691269	hsa-miR-1185-5p	HITS-CLIP	23313552
MIRT691268	hsa-miR-3679-5p	HITS-CLIP	23313552
MIRT691267	hsa-miR-3605-5p	HITS-CLIP	23313552
MIRT691266	hsa-miR-4764-5p	HITS-CLIP	23313552
MIRT1016510	hsa-miR-1178	CLIP-seq
MIRT1016511	hsa-miR-128	CLIP-seq
MIRT1016512	hsa-miR-1283	CLIP-seq
MIRT1016513	hsa-miR-15a	CLIP-seq
MIRT1016514	hsa-miR-15b	CLIP-seq
MIRT1016515	hsa-miR-16	CLIP-seq
MIRT1016516	hsa-miR-195	CLIP-seq
MIRT1016517	hsa-miR-214	CLIP-seq
MIRT1016518	hsa-miR-3180-5p	CLIP-seq
MIRT1016519	hsa-miR-338-3p	CLIP-seq
MIRT1016520	hsa-miR-3619-5p	CLIP-seq
MIRT1016521	hsa-miR-3660	CLIP-seq
MIRT1016522	hsa-miR-3690	CLIP-seq
MIRT1016523	hsa-miR-424	CLIP-seq
MIRT1016524	hsa-miR-4254	CLIP-seq
MIRT1016525	hsa-miR-4468	CLIP-seq
MIRT1016526	hsa-miR-4526	CLIP-seq
MIRT1016527	hsa-miR-4530	CLIP-seq
MIRT1016528	hsa-miR-4786-5p	CLIP-seq
MIRT1016529	hsa-miR-483-3p	CLIP-seq
MIRT1016530	hsa-miR-497	CLIP-seq
MIRT1016531	hsa-miR-503	CLIP-seq
MIRT1016532	hsa-miR-518a-3p	CLIP-seq
MIRT1016533	hsa-miR-518b	CLIP-seq
MIRT1016534	hsa-miR-518c	CLIP-seq
MIRT1016535	hsa-miR-518d-3p	CLIP-seq
MIRT1016536	hsa-miR-518f	CLIP-seq
MIRT1016537	hsa-miR-558	CLIP-seq
MIRT1016538	hsa-miR-634	CLIP-seq
MIRT1016539	hsa-miR-659	CLIP-seq
MIRT1016540	hsa-miR-761	CLIP-seq
MIRT1016541	hsa-miR-767-3p	CLIP-seq
MIRT2000889	hsa-miR-101	CLIP-seq
MIRT2000890	hsa-miR-144	CLIP-seq
MIRT2000891	hsa-miR-1914	CLIP-seq
MIRT2000892	hsa-miR-218	CLIP-seq
MIRT2000893	hsa-miR-3648	CLIP-seq
MIRT2000894	hsa-miR-4436b-5p	CLIP-seq
MIRT2000895	hsa-miR-4698	CLIP-seq
MIRT2000896	hsa-miR-4753-5p	CLIP-seq
MIRT2000897	hsa-miR-548aa	CLIP-seq
MIRT2000898	hsa-miR-582-5p	CLIP-seq
MIRT2000899	hsa-miR-636	CLIP-seq
MIRT1016539	hsa-miR-659	CLIP-seq
MIRT1016510	hsa-miR-1178	CLIP-seq
MIRT2234304	hsa-miR-188-5p	CLIP-seq
MIRT2234305	hsa-miR-1909	CLIP-seq
MIRT2234306	hsa-miR-204	CLIP-seq
MIRT2234307	hsa-miR-211	CLIP-seq
MIRT1016517	hsa-miR-214	CLIP-seq
MIRT1016518	hsa-miR-3180-5p	CLIP-seq
MIRT2234308	hsa-miR-320a	CLIP-seq
MIRT2234309	hsa-miR-320b	CLIP-seq
MIRT2234310	hsa-miR-320c	CLIP-seq
MIRT2234311	hsa-miR-320d	CLIP-seq
MIRT1016519	hsa-miR-338-3p	CLIP-seq
MIRT1016520	hsa-miR-3619-5p	CLIP-seq
MIRT1016521	hsa-miR-3660	CLIP-seq
MIRT1016522	hsa-miR-3690	CLIP-seq
MIRT2234312	hsa-miR-3960	CLIP-seq
MIRT1016524	hsa-miR-4254	CLIP-seq
MIRT2234313	hsa-miR-4286	CLIP-seq
MIRT2234314	hsa-miR-4311	CLIP-seq
MIRT2234315	hsa-miR-4429	CLIP-seq
MIRT1016526	hsa-miR-4526	CLIP-seq
MIRT1016527	hsa-miR-4530	CLIP-seq
MIRT2234316	hsa-miR-4758-3p	CLIP-seq
MIRT1016529	hsa-miR-483-3p	CLIP-seq
MIRT2234317	hsa-miR-483-5p	CLIP-seq
MIRT1016531	hsa-miR-503	CLIP-seq
MIRT1016532	hsa-miR-518a-3p	CLIP-seq
MIRT1016533	hsa-miR-518b	CLIP-seq
MIRT1016534	hsa-miR-518c	CLIP-seq
MIRT1016535	hsa-miR-518d-3p	CLIP-seq
MIRT1016536	hsa-miR-518f	CLIP-seq
MIRT1016537	hsa-miR-558	CLIP-seq
MIRT2234318	hsa-miR-635	CLIP-seq
MIRT2234319	hsa-miR-662	CLIP-seq
MIRT1016540	hsa-miR-761	CLIP-seq
MIRT1016541	hsa-miR-767-3p	CLIP-seq
MIRT2538381	hsa-miR-1225-3p	CLIP-seq
MIRT2538382	hsa-miR-1266	CLIP-seq
MIRT2000891	hsa-miR-1914	CLIP-seq
MIRT2538383	hsa-miR-3127-5p	CLIP-seq
MIRT2538384	hsa-miR-3194-5p	CLIP-seq
MIRT2538385	hsa-miR-3195	CLIP-seq
MIRT2538386	hsa-miR-3918	CLIP-seq
MIRT2538387	hsa-miR-4290	CLIP-seq
MIRT2538388	hsa-miR-4304	CLIP-seq
MIRT2538389	hsa-miR-4518	CLIP-seq
MIRT2538390	hsa-miR-4640-5p	CLIP-seq
MIRT2538391	hsa-miR-4641	CLIP-seq
MIRT2538392	hsa-miR-4687-5p	CLIP-seq
MIRT2538393	hsa-miR-4690-3p	CLIP-seq
MIRT2538394	hsa-miR-4726-5p	CLIP-seq
MIRT2538395	hsa-miR-665	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21516116, 24722188, 25416956, 28514442, 29042515, 32296183, 33961781, 34887561
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	21636303
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	20676083, 29042515
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	IMP	32395830
GO:0005829	Component	Cytosol	NAS	25535373
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	20676083
GO:0006620	Process	Post-translational protein targeting to endoplasmic reticulum membrane	IDA	25535373
GO:0031647	Process	Regulation of protein stability	IDA	21636303
GO:0036503	Process	ERAD pathway	IMP	21636303
GO:0036506	Process	Maintenance of unfolded protein	IMP	21636303
GO:0045048	Process	Protein insertion into ER membrane	IBA
GO:0045048	Process	Protein insertion into ER membrane	IEA
GO:0045048	Process	Protein insertion into ER membrane	IMP	32395830
GO:0051087	Function	Protein-folding chaperone binding	IPI	25535373
GO:0071816	Process	Tail-anchored membrane protein insertion into ER membrane	IDA	25535373
GO:0071816	Process	Tail-anchored membrane protein insertion into ER membrane	IMP	20676083
GO:0071818	Component	BAT3 complex	IBA
GO:0071818	Component	BAT3 complex	IDA	20676083, 21636303, 25535373
GO:0071818	Component	BAT3 complex	IPI	25535373
GO:0140597	Function	Protein carrier chaperone	IMP	21636303

MIM	HGNC	e!Ensembl
612056	21690	ENSG00000239857

Q7L5D6

Protein name

Golgi to ER traffic protein 4 homolog (Conserved edge-expressed protein) (Transmembrane domain recognition complex 35 kDa subunit) (TRC35)

Protein function

As part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates in their proper delivery to the endoplasmic reticulum or alternati

PDB

6AU8 , 7RU9 , 7RUA , 7RUC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04190	DUF410	56 → 306	Protein of unknown function (DUF410)	Family

Sequence

MAAAAAMAEQESARNGGRNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLFFRYMSQSKHT
EARELMYSGALLFFSHGQQNSAADLSMLVLESLEKAEVEVADELLENLAKVFSLMDPNSP
ERVTFVSRALKWSSGGSGKLGHPRLHQLLALTLWKEQNYCESRYHFLHSADGEGCANMLV
EYSTSRGFRSEVDMFVAQAVLQFLCLKNKSSASVVFTTYTQKHPSIEDGPPFVEPLLNFI
WFLLLAVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGN
LLTSLMGSSEQEDGEESPSDGSPIELD

Sequence length

327

Interactions

View interactions

	KEGG
	Protein export

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital disorder of glycosylation, type IIy	Uncertain significance	ClinVar ClinVar, Disgenet, GenCC, HPO ClinVar, Disgenet, GenCC, HPO ClinVar, Disgenet, GenCC, HPO	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GET4 deficiency	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GET4-related disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33850477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	32395830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Facial Dysmorphism with Multiple Malformations	Facial dysmorphism syndrome	Pubtator	32395830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	32395830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36142544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	32395830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	32395830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GET4 (guided entry of tail-anchored proteins factor 4)