Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51586
Gene name	Mediator complex subunit 15
Gene symbol	MED15
Synonyms (NCBI Gene)	ARC105CAG7ACTG7APCQAPTIG-1TIG1TNRC7
Chromosome	22
Chromosome location	22q11.21
Summary	The protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the

144

Show/Hide all (144)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047371	hsa-miR-34a-5p	CLASH	23622248
MIRT045202	hsa-miR-186-5p	CLASH	23622248
MIRT042961	hsa-miR-324-3p	CLASH	23622248
MIRT042132	hsa-miR-484	CLASH	23622248
MIRT037735	hsa-miR-744-5p	CLASH	23622248
MIRT1141025	hsa-miR-1207-5p	CLIP-seq
MIRT1141026	hsa-miR-1271	CLIP-seq
MIRT1141027	hsa-miR-128	CLIP-seq
MIRT1141028	hsa-miR-182	CLIP-seq
MIRT1141029	hsa-miR-205	CLIP-seq
MIRT1141030	hsa-miR-27a	CLIP-seq
MIRT1141031	hsa-miR-27b	CLIP-seq
MIRT1141032	hsa-miR-298	CLIP-seq
MIRT1141033	hsa-miR-3144-5p	CLIP-seq
MIRT1141034	hsa-miR-3191	CLIP-seq
MIRT1141035	hsa-miR-3660	CLIP-seq
MIRT1141036	hsa-miR-3686	CLIP-seq
MIRT1141037	hsa-miR-3714	CLIP-seq
MIRT1141038	hsa-miR-4277	CLIP-seq
MIRT1141039	hsa-miR-4459	CLIP-seq
MIRT1141040	hsa-miR-4462	CLIP-seq
MIRT1141041	hsa-miR-4512	CLIP-seq
MIRT1141042	hsa-miR-4526	CLIP-seq
MIRT1141043	hsa-miR-4652-5p	CLIP-seq
MIRT1141044	hsa-miR-4695-5p	CLIP-seq
MIRT1141045	hsa-miR-4733-5p	CLIP-seq
MIRT1141046	hsa-miR-4736	CLIP-seq
MIRT1141047	hsa-miR-4763-3p	CLIP-seq
MIRT1141048	hsa-miR-4793-5p	CLIP-seq
MIRT1141049	hsa-miR-491-5p	CLIP-seq
MIRT1141050	hsa-miR-513a-5p	CLIP-seq
MIRT1141051	hsa-miR-552	CLIP-seq
MIRT1141052	hsa-miR-96	CLIP-seq
MIRT1141053	hsa-miR-1185	CLIP-seq
MIRT1141054	hsa-miR-1343	CLIP-seq
MIRT1141055	hsa-miR-149	CLIP-seq
MIRT1141056	hsa-miR-1972	CLIP-seq
MIRT1141057	hsa-miR-224	CLIP-seq
MIRT1141058	hsa-miR-2278	CLIP-seq
MIRT1141059	hsa-miR-3064-5p	CLIP-seq
MIRT1141060	hsa-miR-3126-3p	CLIP-seq
MIRT1141061	hsa-miR-3189-3p	CLIP-seq
MIRT1141062	hsa-miR-3192	CLIP-seq
MIRT1141063	hsa-miR-328	CLIP-seq
MIRT1141064	hsa-miR-3605-5p	CLIP-seq
MIRT1141065	hsa-miR-3657	CLIP-seq
MIRT1141035	hsa-miR-3660	CLIP-seq
MIRT1141066	hsa-miR-3679-5p	CLIP-seq
MIRT1141067	hsa-miR-3689a-3p	CLIP-seq
MIRT1141068	hsa-miR-3689c	CLIP-seq
MIRT1141069	hsa-miR-4293	CLIP-seq
MIRT1141039	hsa-miR-4459	CLIP-seq
MIRT1141041	hsa-miR-4512	CLIP-seq
MIRT1141070	hsa-miR-4520a-3p	CLIP-seq
MIRT1141042	hsa-miR-4526	CLIP-seq
MIRT1141071	hsa-miR-4669	CLIP-seq
MIRT1141044	hsa-miR-4695-5p	CLIP-seq
MIRT1141072	hsa-miR-4717-3p	CLIP-seq
MIRT1141073	hsa-miR-4717-5p	CLIP-seq
MIRT1141074	hsa-miR-4728-5p	CLIP-seq
MIRT1141075	hsa-miR-4794	CLIP-seq
MIRT1141076	hsa-miR-4802-3p	CLIP-seq
MIRT1141077	hsa-miR-4802-5p	CLIP-seq
MIRT1141078	hsa-miR-544b	CLIP-seq
MIRT1141035	hsa-miR-3660	CLIP-seq
MIRT1141039	hsa-miR-4459	CLIP-seq
MIRT1141042	hsa-miR-4526	CLIP-seq
MIRT1141044	hsa-miR-4695-5p	CLIP-seq
MIRT2040003	hsa-miR-342-5p	CLIP-seq
MIRT2040004	hsa-miR-4664-5p	CLIP-seq
MIRT1141037	hsa-miR-3714	CLIP-seq
MIRT2568935	hsa-miR-1207-3p	CLIP-seq
MIRT2568936	hsa-miR-1250	CLIP-seq
MIRT2568937	hsa-miR-138	CLIP-seq
MIRT2568938	hsa-miR-15a	CLIP-seq
MIRT2568939	hsa-miR-15b	CLIP-seq
MIRT2568940	hsa-miR-16	CLIP-seq
MIRT2568941	hsa-miR-1908	CLIP-seq
MIRT2568942	hsa-miR-195	CLIP-seq
MIRT2568943	hsa-miR-214	CLIP-seq
MIRT2568944	hsa-miR-3065-3p	CLIP-seq
MIRT2568945	hsa-miR-3189-5p	CLIP-seq
MIRT2568946	hsa-miR-3194-5p	CLIP-seq
MIRT2568947	hsa-miR-3616-3p	CLIP-seq
MIRT2568948	hsa-miR-3619-5p	CLIP-seq
MIRT2568949	hsa-miR-3907	CLIP-seq
MIRT2568950	hsa-miR-424	CLIP-seq
MIRT2568951	hsa-miR-4290	CLIP-seq
MIRT2568952	hsa-miR-4291	CLIP-seq
MIRT2568953	hsa-miR-4292	CLIP-seq
MIRT2568954	hsa-miR-4308	CLIP-seq
MIRT2568955	hsa-miR-4446-3p	CLIP-seq
MIRT2568956	hsa-miR-4456	CLIP-seq
MIRT2568957	hsa-miR-4469	CLIP-seq
MIRT2568958	hsa-miR-4530	CLIP-seq
MIRT2568959	hsa-miR-4640-5p	CLIP-seq
MIRT2568960	hsa-miR-4649-3p	CLIP-seq
MIRT2568961	hsa-miR-4656	CLIP-seq
MIRT2568962	hsa-miR-4687-5p	CLIP-seq
MIRT2568963	hsa-miR-4706	CLIP-seq
MIRT2568964	hsa-miR-4721	CLIP-seq
MIRT2568965	hsa-miR-4726-5p	CLIP-seq
MIRT2568966	hsa-miR-4749-5p	CLIP-seq
MIRT2568967	hsa-miR-4758-3p	CLIP-seq
MIRT2568968	hsa-miR-497	CLIP-seq
MIRT2568969	hsa-miR-663	CLIP-seq
MIRT2568970	hsa-miR-761	CLIP-seq
MIRT2568971	hsa-miR-922	CLIP-seq
MIRT2568972	hsa-miR-939	CLIP-seq
MIRT2568935	hsa-miR-1207-3p	CLIP-seq
MIRT2568936	hsa-miR-1250	CLIP-seq
MIRT2568937	hsa-miR-138	CLIP-seq
MIRT2568938	hsa-miR-15a	CLIP-seq
MIRT2568939	hsa-miR-15b	CLIP-seq
MIRT2568940	hsa-miR-16	CLIP-seq
MIRT2568941	hsa-miR-1908	CLIP-seq
MIRT2568942	hsa-miR-195	CLIP-seq
MIRT2568943	hsa-miR-214	CLIP-seq
MIRT2568944	hsa-miR-3065-3p	CLIP-seq
MIRT2568945	hsa-miR-3189-5p	CLIP-seq
MIRT2568946	hsa-miR-3194-5p	CLIP-seq
MIRT2568947	hsa-miR-3616-3p	CLIP-seq
MIRT2568948	hsa-miR-3619-5p	CLIP-seq
MIRT2568949	hsa-miR-3907	CLIP-seq
MIRT2568950	hsa-miR-424	CLIP-seq
MIRT2568952	hsa-miR-4291	CLIP-seq
MIRT2568953	hsa-miR-4292	CLIP-seq
MIRT2568954	hsa-miR-4308	CLIP-seq
MIRT2568955	hsa-miR-4446-3p	CLIP-seq
MIRT2568956	hsa-miR-4456	CLIP-seq
MIRT2568958	hsa-miR-4530	CLIP-seq
MIRT2568959	hsa-miR-4640-5p	CLIP-seq
MIRT2568960	hsa-miR-4649-3p	CLIP-seq
MIRT2568961	hsa-miR-4656	CLIP-seq
MIRT2568963	hsa-miR-4706	CLIP-seq
MIRT2568964	hsa-miR-4721	CLIP-seq
MIRT2568965	hsa-miR-4726-5p	CLIP-seq
MIRT2568966	hsa-miR-4749-5p	CLIP-seq
MIRT2568967	hsa-miR-4758-3p	CLIP-seq
MIRT2568968	hsa-miR-497	CLIP-seq
MIRT2568969	hsa-miR-663	CLIP-seq
MIRT2568970	hsa-miR-761	CLIP-seq
MIRT2568971	hsa-miR-922	CLIP-seq
MIRT2568972	hsa-miR-939	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0005515	Function	Protein binding	IPI	16799563, 16904669, 17500595, 18385733, 18568018, 24882805, 32814053, 35271311
GO:0005634	Component	Nucleus	IDA	24882805
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	NAS	11559591
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	NAS	11559591
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	NAS	11559591
GO:0070847	Component	Core mediator complex	IBA
GO:0070847	Component	Core mediator complex	IPI	24882805

MIM	HGNC	e!Ensembl
607372	14248	ENSG00000099917

Q96RN5

Protein name

Mediator of RNA polymerase II transcription subunit 15 (Activator-recruited cofactor 105 kDa component) (ARC105) (CTG repeat protein 7a) (Mediator complex subunit 15) (Positive cofactor 2 glutamine/Q-rich-associated protein) (PC2 glutamine/Q-rich-associat

Protein function

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RN

PDB

2GUT , 7EMF , 7ENA , 7ENC , 7ENJ , 7LBM , 8GXQ , 8GXS , 8J9A , 8T9D , 8TQW , 8TRH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09606	Med15	17 → 787	ARC105 or Med15 subunit of Mediator complex non-fungal	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues examined, including heart, brain, lung, spleen, thymus, pancreas, blood leukocyte and placenta. However, the level of expression varied, with highest expression in the placenta and peripheral blood and lowest i

Sequence

MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVA
RLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMG
QPMSLSGQPPPGTSGMAPHSMAVVSTATPQTQLQLQQVALQQQQQQQQFQQQQQAALQQQ
QQQQQQQQFQAQQSAMQQQFQAVVQQQQQLQQQQQQQQHLIKLHHQNQQQIQQQQQQLQR
IAQLQLQQQQQQQQQQQQQQQQALQAQPPIQQPPMQQPQPPPSQALPQQLQQMHHTQHHQ
PPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVRAPMVVQQPPVQ
PQVQQQQTAVQTAQAAQMVAPGVQMITEALAQGGMHIRARFPPTTAVSAIPSSSIPLGRQ
PMAQVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSF
LPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLS
KYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMA
VPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVC
TRKRRLEDDERQSIPSVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPP
LELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSV
HQACLSAA

Sequence length

788

Interactions

View interactions

	Reactome
			PPARA activates gene expression Generic Transcription Pathway Transcriptional regulation of white adipocyte differentiation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Aganglionic megacolon	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIRSCHSPRUNG DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOAFFECTIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (56)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	15328191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	25791637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	18004747, 18242387, 21694441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	18006010, 30127891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25791637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31013839, 32439976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11929948, 19806788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	26377566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35069777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	18006010, 30127891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29400661, 29713041, 31828108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23562092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21575264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21575264	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29400661, 29713041, 31828108		★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	11414760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	15886297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	17550320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	18004747, 24324057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	25205790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	24014597		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15059893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31013839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24006221, 29556287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25791637	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29556287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31013839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	31013839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14691453, 15059893, 15328191, 18242387, 21694441, 24324057, 24374838, 25791637, 27974704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19806788, 20021617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	18006010, 30127891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15059893, 19806788, 29556287, 30127891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21575264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	31013839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	15455391, 19737656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11929948, 15059893, 15455391, 15886297, 16134180, 19806788, 21575264, 22126303, 24006221, 25791637, 27989102, 28678839, 29400661, 29556287, 29902837, 30127891 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	21591998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	31013839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	25791637	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	31013839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14691453, 15059893, 15328191, 18242387, 21694441, 24324057, 24374838, 27974704, 27989102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14691453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26377566, 27974704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	8601727		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29400661, 29713041, 31828108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	PSYGENET_DG	12497610		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	12497610, 15318033		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	12497610, 15318033		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15318033		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Shprintzen syndrome	Shprintzen Syndrome	BEFREE	11414760, 15318033, 22796526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16128742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25791637, 32439976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25791637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19806788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	26377566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26377566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MED15 (mediator complex subunit 15)