HDAC7 (histone deacetylase 7)

Gene

• Entrez ID: 51564
• Gene name: Histone deacetylase 7
• Gene symbol: HDAC7
• Synonyms (NCBI Gene): HD7, HD7A, HDAC7A
• Chromosome: 12
• Chromosome location: 12q13.11
• Summary: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene h

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT045413	hsa-miR-149-5p	CLASH	23622248
MIRT040075	hsa-miR-615-3p	CLASH	23622248
MIRT438365	hsa-miR-140-5p	Luciferase reporter assay, Western blot	24530397
MIRT438365	hsa-miR-140-5p	Luciferase reporter assay, Western blot	24530397
MIRT438365	hsa-miR-140-5p	Luciferase reporter assay, Western blot	24530397
MIRT438365	hsa-miR-140-5p	Luciferase reporter assay, Western blot	24530397
MIRT732960	hsa-miR-1260a	Immunofluorescence, Immunohistochemistry (IHC), RNA-seq, qRT-PCR, Western blotting	34256779
MIRT1042526	hsa-miR-3171	CLIP-seq
MIRT1042527	hsa-miR-3663-3p	CLIP-seq
MIRT1042528	hsa-miR-4278	CLIP-seq
MIRT1042529	hsa-miR-4459	CLIP-seq
MIRT1042530	hsa-miR-4685-5p	CLIP-seq
MIRT1042531	hsa-miR-4686	CLIP-seq
MIRT1042532	hsa-miR-4700-3p	CLIP-seq
MIRT1042533	hsa-miR-4716-3p	CLIP-seq
MIRT1042534	hsa-miR-4733-3p	CLIP-seq
MIRT1042535	hsa-miR-4761-3p	CLIP-seq
MIRT1042536	hsa-miR-665	CLIP-seq
MIRT1042537	hsa-miR-767-3p	CLIP-seq
MIRT1042538	hsa-miR-2467-3p	CLIP-seq
MIRT1042539	hsa-miR-3170	CLIP-seq
MIRT1042540	hsa-miR-3678-3p	CLIP-seq
MIRT1042541	hsa-miR-4667-5p	CLIP-seq
MIRT1042542	hsa-miR-4700-5p	CLIP-seq
MIRT1042543	hsa-miR-637	CLIP-seq
MIRT2009002	hsa-miR-1224-3p	CLIP-seq
MIRT2009003	hsa-miR-125a-3p	CLIP-seq
MIRT2009004	hsa-miR-1260	CLIP-seq
MIRT2009005	hsa-miR-1260b	CLIP-seq
MIRT2009006	hsa-miR-1280	CLIP-seq
MIRT2009007	hsa-miR-1307	CLIP-seq
MIRT2009008	hsa-miR-150	CLIP-seq
MIRT2009009	hsa-miR-1910	CLIP-seq
MIRT2009010	hsa-miR-2115	CLIP-seq
MIRT2009011	hsa-miR-2117	CLIP-seq
MIRT2009012	hsa-miR-3126-5p	CLIP-seq
MIRT2009013	hsa-miR-3127-3p	CLIP-seq
MIRT1042526	hsa-miR-3171	CLIP-seq
MIRT2009014	hsa-miR-3180-5p	CLIP-seq
MIRT2009015	hsa-miR-342-3p	CLIP-seq
MIRT2009016	hsa-miR-3529	CLIP-seq
MIRT1042527	hsa-miR-3663-3p	CLIP-seq
MIRT2009017	hsa-miR-3665	CLIP-seq
MIRT2009018	hsa-miR-377	CLIP-seq
MIRT2009019	hsa-miR-379	CLIP-seq
MIRT2009020	hsa-miR-3919	CLIP-seq
MIRT2009021	hsa-miR-4273	CLIP-seq
MIRT2009022	hsa-miR-4451	CLIP-seq
MIRT1042529	hsa-miR-4459	CLIP-seq
MIRT2009023	hsa-miR-4481	CLIP-seq
MIRT2009024	hsa-miR-4496	CLIP-seq
MIRT2009025	hsa-miR-4638-5p	CLIP-seq
MIRT2009026	hsa-miR-4643	CLIP-seq
MIRT2009027	hsa-miR-4650-3p	CLIP-seq
MIRT1042530	hsa-miR-4685-5p	CLIP-seq
MIRT1042531	hsa-miR-4686	CLIP-seq
MIRT1042532	hsa-miR-4700-3p	CLIP-seq
MIRT2009028	hsa-miR-4713-5p	CLIP-seq
MIRT1042534	hsa-miR-4733-3p	CLIP-seq
MIRT2009029	hsa-miR-4742-3p	CLIP-seq
MIRT2009030	hsa-miR-4745-5p	CLIP-seq
MIRT1042535	hsa-miR-4761-3p	CLIP-seq
MIRT2009031	hsa-miR-4768-5p	CLIP-seq
MIRT2009032	hsa-miR-4772-5p	CLIP-seq
MIRT2009033	hsa-miR-520a-5p	CLIP-seq
MIRT2009034	hsa-miR-525-5p	CLIP-seq
MIRT2009035	hsa-miR-532-3p	CLIP-seq
MIRT1042536	hsa-miR-665	CLIP-seq
MIRT1042537	hsa-miR-767-3p	CLIP-seq
MIRT2009036	hsa-miR-767-5p	CLIP-seq
MIRT2009037	hsa-miR-873	CLIP-seq
MIRT2009038	hsa-miR-942	CLIP-seq
MIRT2009009	hsa-miR-1910	CLIP-seq
MIRT2009011	hsa-miR-2117	CLIP-seq
MIRT2009021	hsa-miR-4273	CLIP-seq
MIRT2241369	hsa-miR-4687-3p	CLIP-seq
MIRT2241370	hsa-miR-574-3p	CLIP-seq
MIRT2545034	hsa-miR-1178	CLIP-seq
MIRT2545035	hsa-miR-1202	CLIP-seq
MIRT2545036	hsa-miR-1237	CLIP-seq
MIRT2545037	hsa-miR-1248	CLIP-seq
MIRT2545038	hsa-miR-1254	CLIP-seq
MIRT2009011	hsa-miR-2117	CLIP-seq
MIRT2545039	hsa-miR-3116	CLIP-seq
MIRT2545040	hsa-miR-326	CLIP-seq
MIRT2545041	hsa-miR-330-3p	CLIP-seq
MIRT2545042	hsa-miR-330-5p	CLIP-seq
MIRT2009015	hsa-miR-342-3p	CLIP-seq
MIRT2545043	hsa-miR-3667-5p	CLIP-seq
MIRT2545044	hsa-miR-3675-3p	CLIP-seq
MIRT2545045	hsa-miR-3690	CLIP-seq
MIRT2009018	hsa-miR-377	CLIP-seq
MIRT2545046	hsa-miR-3972	CLIP-seq
MIRT2009021	hsa-miR-4273	CLIP-seq
MIRT2545047	hsa-miR-4488	CLIP-seq
MIRT2545048	hsa-miR-4489	CLIP-seq
MIRT2545049	hsa-miR-4509	CLIP-seq
MIRT2545050	hsa-miR-4514	CLIP-seq
MIRT2545051	hsa-miR-4635	CLIP-seq
MIRT2009026	hsa-miR-4643	CLIP-seq
MIRT2545052	hsa-miR-4650-5p	CLIP-seq
MIRT2241369	hsa-miR-4687-3p	CLIP-seq
MIRT2545053	hsa-miR-4690-5p	CLIP-seq
MIRT2545054	hsa-miR-4692	CLIP-seq
MIRT2545055	hsa-miR-4697-5p	CLIP-seq
MIRT2545056	hsa-miR-4709-3p	CLIP-seq
MIRT2545057	hsa-miR-4744	CLIP-seq
MIRT2545058	hsa-miR-4755-3p	CLIP-seq
MIRT2545059	hsa-miR-526b	CLIP-seq
MIRT2545060	hsa-miR-548u	CLIP-seq
MIRT2545061	hsa-miR-606	CLIP-seq
MIRT2545062	hsa-miR-711	CLIP-seq
MIRT2545063	hsa-miR-940	CLIP-seq
MIRT2545034	hsa-miR-1178	CLIP-seq
MIRT2545035	hsa-miR-1202	CLIP-seq
MIRT2545036	hsa-miR-1237	CLIP-seq
MIRT2545037	hsa-miR-1248	CLIP-seq
MIRT2545038	hsa-miR-1254	CLIP-seq
MIRT2545039	hsa-miR-3116	CLIP-seq
MIRT2009015	hsa-miR-342-3p	CLIP-seq
MIRT2545045	hsa-miR-3690	CLIP-seq
MIRT2009018	hsa-miR-377	CLIP-seq
MIRT2545046	hsa-miR-3972	CLIP-seq
MIRT2545051	hsa-miR-4635	CLIP-seq
MIRT2009026	hsa-miR-4643	CLIP-seq
MIRT2545052	hsa-miR-4650-5p	CLIP-seq
MIRT2545056	hsa-miR-4709-3p	CLIP-seq
MIRT2545059	hsa-miR-526b	CLIP-seq
MIRT2545062	hsa-miR-711	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BCL6	Repression	11929873
MEF2D	Unknown	15171250
NFKB1	Unknown	21243522
RELA	Unknown	21243522

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001570	Process	Vasculogenesis	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0004407	Function	Histone deacetylase activity	IBA
GO:0004407	Function	Histone deacetylase activity	IEA
GO:0004407	Function	Histone deacetylase activity	ISS
GO:0005080	Function	Protein kinase C binding	IPI	20188095
GO:0005515	Function	Protein binding	IPI	15161933, 15194749, 15778465, 17360565, 17962809, 18339811, 20224040, 22155184, 23565059, 23752268, 24658140, 25416956, 28514442, 31980649, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	16980613, 17997710
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16980613, 17997710
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006476	Process	Protein deacetylation	IMP	30538141
GO:0007043	Process	Cell-cell junction assembly	IEA
GO:0010558	Process	Negative regulation of macromolecule biosynthetic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016925	Process	Protein sumoylation	TAS
GO:0019789	Function	SUMO transferase activity	TAS
GO:0019901	Function	Protein kinase binding	IPI	16980613
GO:0032703	Process	Negative regulation of interleukin-2 production	IDA	17360565
GO:0033558	Function	Protein lysine deacetylase activity	IDA	30538141, 37369679
GO:0033558	Function	Protein lysine deacetylase activity	IEA
GO:0040029	Process	Epigenetic regulation of gene expression	IBA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IMP	17997710
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050684	Process	Regulation of mRNA processing	IDA	37369679
GO:0071889	Function	14-3-3 protein binding	IDA	16980613
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IMP	19351956
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	17360565, 20590529
GO:0140694	Process	Membraneless organelle assembly	IDA	37474102
GO:0141221	Function	Histone deacetylase activity, hydrolytic mechanism	IEA
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	IMP	25411248

Other IDs

• MIM: 606542
• HGNC: 14067
• e!Ensembl: ENSG00000061273

Protein

• UniProt ID: Q8WUI4
• Protein name: Histone deacetylase 7 (HD7) (EC 3.5.1.98) (Histone deacetylase 7A) (HD7a) (Protein deacetylase HDAC7) (EC 3.5.1.-)
• Protein function: Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) (By similarity). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional re
• PDB: 3C0Y, 3C0Z, 3C10, 3ZNR, 3ZNS, 8Q9Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00850	Hist_deacetyl	541 → 859	Histone deacetylase domain	Domain

• Sequence:

  MDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVG
  PQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPL
  ETEGATRSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKE
  SAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQETSV
  APFALPTVSLLPAITLGLPAPARADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEAGG
  TLPSRLQPILLLDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRSEP
  LPPSATAPPPPGPMQPRLEQLKTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGPGQVV
  DDGLEHRELGHGQPEARGPAPLQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGGHRP
  LSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSR
  HPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLD
  NGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNG
  FAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQ
  DPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRI
  VVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALE
  GGHDLTAICDASEACVAALLGNRVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQR
  LASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL

• Sequence length: 952

Pathways

KEGG:

Neutrophil extracellular trap formation
Alcoholism
Viral carcinogenesis

Reactome:

Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
SUMOylation of DNA damage response and repair proteins
Notch-HLH transcription pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	20636436		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	25275504		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	30929738		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29664401		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25173798, 31375747		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22892281, 31081251	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	25675295		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35345359, 35595735	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29126425, 29490434, 30628670		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29374219	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31088315	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24200999, 27694895		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	32364532	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	19784544	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	23603763, 26974007		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	19784544		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28260932		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	30940143		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	38274809	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26423403, 29071516, 30076612		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26423403	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30076612	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19784544, 30854734		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27796421	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27796421	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27796421, 30088095		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35595735	Associate	★☆☆☆☆ Found in Text Mining only
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	29456726		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26272600		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26272600		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30654849	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35545840, 37528157	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	39329199	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	22865920	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32364532	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	36293392	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22172637	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26359372		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	23128233		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	23128233		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	26839444	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	24214631	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25675295		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28982308	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28982308	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29126425		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	25675295		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	19074726		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25173798, 31081251, 31375747		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29126425, 29490434, 30628670		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24200999, 27694895		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28299580		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21120446, 25173798, 25675295, 30417746, 31081251, 31375747		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	26898430		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	28178760		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	36755464	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30660010		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17876049, 25275504, 29071516, 29490434, 31081251		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29490434		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19784544	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	19784544	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	19784544		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24200999, 27694895		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18506539		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	25275504		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25275504, 29374219	Associate	★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	29706035		★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 1	Polycystic kidney disease	BEFREE	27013613		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	GWASDB_DG	21151127, 23603763		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37143720	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22172637	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28299580		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32284070	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26192919, 26974007, 28067908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Varicose Veins	Varicose veins	Pubtator	36293392	Associate	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	GWASCAT_DG	30566020, 30998689		★☆☆☆☆ Found in Text Mining only