Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51562
Gene name	MAP3K12 binding inhibitory protein 1
Gene symbol	MBIP
Synonyms (NCBI Gene)	-
Chromosome	14
Chromosome location	14q13.3

Show/Hide all (97)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029808	hsa-miR-26b-5p	Microarray	19088304
MIRT048560	hsa-miR-100-5p	CLASH	23622248
MIRT1135181	hsa-miR-1255a	CLIP-seq
MIRT1135182	hsa-miR-1255b	CLIP-seq
MIRT1135183	hsa-miR-1287	CLIP-seq
MIRT1135184	hsa-miR-1305	CLIP-seq
MIRT1135185	hsa-miR-132	CLIP-seq
MIRT1135186	hsa-miR-200b	CLIP-seq
MIRT1135187	hsa-miR-200c	CLIP-seq
MIRT1135188	hsa-miR-212	CLIP-seq
MIRT1135189	hsa-miR-2276	CLIP-seq
MIRT1135190	hsa-miR-27a	CLIP-seq
MIRT1135191	hsa-miR-27b	CLIP-seq
MIRT1135192	hsa-miR-300	CLIP-seq
MIRT1135193	hsa-miR-320a	CLIP-seq
MIRT1135194	hsa-miR-320b	CLIP-seq
MIRT1135195	hsa-miR-320c	CLIP-seq
MIRT1135196	hsa-miR-320d	CLIP-seq
MIRT1135197	hsa-miR-320e	CLIP-seq
MIRT1135198	hsa-miR-3607-5p	CLIP-seq
MIRT1135199	hsa-miR-3613-3p	CLIP-seq
MIRT1135200	hsa-miR-3647-3p	CLIP-seq
MIRT1135201	hsa-miR-3662	CLIP-seq
MIRT1135202	hsa-miR-378	CLIP-seq
MIRT1135203	hsa-miR-378b	CLIP-seq
MIRT1135204	hsa-miR-378c	CLIP-seq
MIRT1135205	hsa-miR-378d	CLIP-seq
MIRT1135206	hsa-miR-378e	CLIP-seq
MIRT1135207	hsa-miR-378f	CLIP-seq
MIRT1135208	hsa-miR-378h	CLIP-seq
MIRT1135209	hsa-miR-378i	CLIP-seq
MIRT1135210	hsa-miR-381	CLIP-seq
MIRT1135211	hsa-miR-3913-3p	CLIP-seq
MIRT1135212	hsa-miR-3919	CLIP-seq
MIRT1135213	hsa-miR-3924	CLIP-seq
MIRT1135214	hsa-miR-3941	CLIP-seq
MIRT1135215	hsa-miR-422a	CLIP-seq
MIRT1135216	hsa-miR-429	CLIP-seq
MIRT1135217	hsa-miR-4429	CLIP-seq
MIRT1135218	hsa-miR-4643	CLIP-seq
MIRT1135219	hsa-miR-466	CLIP-seq
MIRT1135220	hsa-miR-4666-3p	CLIP-seq
MIRT1135221	hsa-miR-4666-5p	CLIP-seq
MIRT1135222	hsa-miR-4672	CLIP-seq
MIRT1135223	hsa-miR-4699-3p	CLIP-seq
MIRT1135224	hsa-miR-4712-3p	CLIP-seq
MIRT1135225	hsa-miR-4789-3p	CLIP-seq
MIRT1135226	hsa-miR-489	CLIP-seq
MIRT1135227	hsa-miR-513a-5p	CLIP-seq
MIRT1135228	hsa-miR-548a-5p	CLIP-seq
MIRT1135229	hsa-miR-548ab	CLIP-seq
MIRT1135230	hsa-miR-548ak	CLIP-seq
MIRT1135231	hsa-miR-548b-5p	CLIP-seq
MIRT1135232	hsa-miR-548c-5p	CLIP-seq
MIRT1135233	hsa-miR-548d-5p	CLIP-seq
MIRT1135234	hsa-miR-548h	CLIP-seq
MIRT1135235	hsa-miR-548i	CLIP-seq
MIRT1135236	hsa-miR-548j	CLIP-seq
MIRT1135237	hsa-miR-548n	CLIP-seq
MIRT1135238	hsa-miR-548w	CLIP-seq
MIRT1135239	hsa-miR-548y	CLIP-seq
MIRT1135240	hsa-miR-559	CLIP-seq
MIRT1135241	hsa-miR-586	CLIP-seq
MIRT1135242	hsa-miR-617	CLIP-seq
MIRT1135184	hsa-miR-1305	CLIP-seq
MIRT2268279	hsa-miR-4282	CLIP-seq
MIRT2268280	hsa-miR-4704-3p	CLIP-seq
MIRT2268281	hsa-miR-4760-3p	CLIP-seq
MIRT2268282	hsa-miR-513a-3p	CLIP-seq
MIRT2268283	hsa-miR-548k	CLIP-seq
MIRT2268284	hsa-miR-579	CLIP-seq
MIRT2268285	hsa-miR-664	CLIP-seq
MIRT2567920	hsa-miR-1278	CLIP-seq
MIRT2567921	hsa-miR-3129-3p	CLIP-seq
MIRT2567922	hsa-miR-3653	CLIP-seq
MIRT2567923	hsa-miR-3658	CLIP-seq
MIRT1135211	hsa-miR-3913-3p	CLIP-seq
MIRT2567924	hsa-miR-3973	CLIP-seq
MIRT2268279	hsa-miR-4282	CLIP-seq
MIRT1135218	hsa-miR-4643	CLIP-seq
MIRT1135219	hsa-miR-466	CLIP-seq
MIRT2268280	hsa-miR-4704-3p	CLIP-seq
MIRT2268281	hsa-miR-4760-3p	CLIP-seq
MIRT1135225	hsa-miR-4789-3p	CLIP-seq
MIRT2567925	hsa-miR-4795-3p	CLIP-seq
MIRT2567926	hsa-miR-485-3p	CLIP-seq
MIRT1135226	hsa-miR-489	CLIP-seq
MIRT2268282	hsa-miR-513a-3p	CLIP-seq
MIRT2567927	hsa-miR-518a-5p	CLIP-seq
MIRT2567928	hsa-miR-527	CLIP-seq
MIRT2567929	hsa-miR-548g	CLIP-seq
MIRT2268283	hsa-miR-548k	CLIP-seq
MIRT2268284	hsa-miR-579	CLIP-seq
MIRT2567930	hsa-miR-582-3p	CLIP-seq
MIRT1135241	hsa-miR-586	CLIP-seq
MIRT2567931	hsa-miR-653	CLIP-seq
MIRT2268285	hsa-miR-664	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18838386
GO:0004860	Function	Protein kinase inhibitor activity	IDA	10801814
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 24981860, 25416956, 25910212, 26871637, 27705803, 27956147, 28514442, 31515488, 32296183, 32814053, 33961781, 35512704
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	19936620
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	22055187
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0010628	Process	Positive regulation of gene expression	IDA	32963352
GO:0042802	Function	Identical protein binding	IPI	16189514, 19060904
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0045995	Process	Regulation of embryonic development	ISO
GO:0045995	Process	Regulation of embryonic development	ISS
GO:0046330	Process	Positive regulation of JNK cascade	IDA	10801814, 32963352
GO:0051302	Process	Regulation of cell division	IDA	20562830
GO:0051302	Process	Regulation of cell division	IEA
GO:0051302	Process	Regulation of cell division	ISS
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	19103755
GO:0051726	Process	Regulation of cell cycle	ISS
GO:0072686	Component	Mitotic spindle	NAS	20562830
GO:0140672	Component	ATAC complex	IDA	18838386, 19936620
GO:0140672	Component	ATAC complex	IEA
GO:0140672	Component	ATAC complex	ISO

MIM	HGNC	e!Ensembl
609431	20427	ENSG00000151332

Q9NS73

Protein name

MAP3K12-binding inhibitory protein 1 (MAPK upstream kinase-binding inhibitory protein) (MUK-binding inhibitory protein)

Protein function

Inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. High expression seen in the heart and lung.

Sequence

MAAATELNRPSSGDRNLERRCRPNLSREVLYEIFRSLHTLVGQLDLRDDVVKITIDWNKL
QSLSAFQPALLFSALEQHILYLQPFLAKLQSPIKEENTTAVEEIGRTEMGNKNEVNDKFS
IGDLQEEEKHKESDLRDVKKTQIHFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVR
EFCNVIDCNQENSCARTDAIFTPYPGFKSHVKVSRVVNTYGPQTRPEGIPGSGHKPNSML
RDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVSFSG
KRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLP

Sequence length

344

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFERENTIATED THYROID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTINODULAR GOITER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC NODULAR GOITER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Benign Hereditary Chorea	Benign Hereditary Chorea	BEFREE	29621620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24805830, 32711446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chorea	Chorea	Pubtator	29621620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Choreoathetosis	Pubtator	29621620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choreoathetosis, Hypothyroidism, And Neonatal Respiratory Distress	Choreoathetosis, Hypothyroidism, And Neonatal Respiratory Distress	BEFREE	28286255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	28753406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	27342578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	27342578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	33903625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MBIP (MAP3K12 binding inhibitory protein 1)