IL23A (interleukin 23 subunit alpha)

Gene

• Entrez ID: 51561
• Gene name: Interleukin 23 subunit alpha
• Gene symbol: IL23A
• Synonyms (NCBI Gene): IL-23, IL-23A, IL23P19, P19, SGRF
• Chromosome: 12
• Chromosome location: 12q13.3
• Summary: This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific su

Transcription factors

Transcription factor	Regulation	Reference
CEBPD	Activation	23028973
E2F1	Unknown	17707233
JUN	Unknown	17569750;22904313
NFKB1	Activation	17569750
NFKB1	Unknown	17707233
RELA	Activation	17569750
RELA	Unknown	17707233

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IEA
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	ISS
GO:0002230	Process	Positive regulation of defense response to virus by host	IBA
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	12421946
GO:0002230	Process	Positive regulation of defense response to virus by host	IEA
GO:0002230	Process	Positive regulation of defense response to virus by host	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IBA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IDA	15114670
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IEA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	ISS
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	NAS	20027291
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	TAS	16751425
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	11114383, 12023369, 18680750, 25416956, 29997244, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	12023369
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0032693	Process	Negative regulation of interleukin-10 production	IMP	16751425
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	20027291
GO:0032729	Process	Positive regulation of type II interferon production	IDA	11114383, 17888176, 20027291
GO:0032729	Process	Positive regulation of type II interferon production	TAS	19088061
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	15265908
GO:0032733	Process	Positive regulation of interleukin-10 production	TAS	18675459
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	20027291
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	16482511, 16751425, 17888176
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	16751425
GO:0032816	Process	Positive regulation of natural killer cell activation	IC	20027291
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IDA	19088061
GO:0034105	Process	Positive regulation of tissue remodeling	IC	16482511
GO:0042098	Process	T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IBA
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	12023369
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	11114383
GO:0043382	Process	Positive regulation of memory T cell differentiation	IEA
GO:0043382	Process	Positive regulation of memory T cell differentiation	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045519	Function	Interleukin-23 receptor binding	IDA	11114383
GO:0045519	Function	Interleukin-23 receptor binding	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	17888176
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046635	Process	Positive regulation of alpha-beta T cell activation	IEA
GO:0048771	Process	Tissue remodeling	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IC	16482511
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	15114670, 20027291
GO:0051135	Process	Positive regulation of NK T cell activation	IC	20027291
GO:0051135	Process	Positive regulation of NK T cell activation	IDA	19088061
GO:0051142	Process	Positive regulation of NK T cell proliferation	IDA	19088061
GO:0051607	Process	Defense response to virus	IEA
GO:0070743	Component	Interleukin-23 complex	IBA
GO:0070743	Component	Interleukin-23 complex	IDA	11114383
GO:0070743	Component	Interleukin-23 complex	IEA
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	19088061
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	TAS	20428758
GO:1902107	Process	Positive regulation of leukocyte differentiation	IEA
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	IEA
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	ISS
GO:2000330	Process	Positive regulation of T-helper 17 cell lineage commitment	IBA
GO:2000330	Process	Positive regulation of T-helper 17 cell lineage commitment	IEA
GO:2000330	Process	Positive regulation of T-helper 17 cell lineage commitment	ISS

Other IDs

• MIM: 605580
• HGNC: 15488
• e!Ensembl: ENSG00000110944

Protein

• UniProt ID: Q9NPF7
• Protein name: Interleukin-23 subunit alpha (IL-23 subunit alpha) (IL-23-A) (Interleukin-23 subunit p19) (IL-23p19)
• Protein function: Associates with IL12B to form the pro-inflammatory cytokine IL-23 that plays different roles in innate and adaptive immunity (PubMed:11114383). Released by antigen-presenting cells such as dendritic cells or macrophages, binds to a heterodimeric
• PDB: 3D85, 3D87, 3DUH, 3QWR, 4GRW, 5MJ3, 5MJ4, 5MXA, 5MZV, 5NJD, 6UIB, 6WDQ, 8CR8, 8OE4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16649	IL23	28 → 184	Interleukin 23 subunit alpha	Domain

• Tissue specificity: TISSUE SPECIFICITY: Secreted by activated dendritic and phagocytic cells and keratinocytes. Also expressed by dermal Langerhans cells (at protein level). {ECO:0000269|PubMed:11114383, ECO:0000269|PubMed:16424222}.
• Sequence:

  MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG
  DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
  VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF
  AHGAATLSP

• Sequence length: 189

Pathways

KEGG:

Cytokine-cytokine receptor interaction
C-type lectin receptor signaling pathway
JAK-STAT signaling pathway
Th17 cell differentiation
Pertussis
Tuberculosis
Pathways in cancer
Inflammatory bowel disease
Rheumatoid arthritis

Reactome:

Interleukin-4 and Interleukin-13 signaling
Interleukin-23 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	21681782		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	8946928		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	3042790, 30914194		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	25015728		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	21547355		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	22193967		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	20515574		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	2787798, 3872164, 6090008, 6331549, 6833950, 8946928		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	29168048		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	29417135, 31268476		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	30851706		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	27864285, 31020341		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	31087753		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	31087753		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	28853491		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17916583		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	31118040	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	17945537		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	30686933	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	35942210	Stimulate	★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	29623491		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	19247658, 19333939, 21965815, 22045842, 22213179, 23083754, 23740229, 23969080, 24547735, 25627863, 26080615, 27641916, 27846758, 28099816, 28728847, 28850053, 29200018, 29409751, 29869839, 29945918, 30057583, 30138619, 30266977, 30443744, 30463609, 30576610, 30740926, 30886835, 31347941, 31711818, 31830775		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26983359		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	22965992		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	22965992, 31320700		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	18190588, 29330562		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23023190, 26261042, 26830200, 29618473, 30328797, 30389414, 31237437, 31264927		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17888176, 19034457, 19900478, 21670317, 25253467, 25354400, 27895169, 28850053, 29414600, 29765156, 30057583, 31778214		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	25452564, 36088336	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16741508, 21623003, 22298274, 22541888, 27543964, 30602780, 33153894, 33243781, 33746955, 34884474, 35297512, 37679036, 38124740, 38301504, 39711043	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	27542294, 29317264, 40429765	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18276743, 19815670, 20840651, 22809173, 26062018, 26956410, 2774054, 34403509, 37809066	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22736176, 24288552, 32868411	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	LHGDN	18752933, 19040306		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	20875338, 21623003, 22541888, 23673284, 24957500, 26108918, 27586804, 27666819, 28441904, 28850053, 29148410, 29148561, 29330320, 29439292, 30172115, 30196070, 30206447, 30266977, 30584776, 30858782, 30891646, 30980732, 31070869, 31170010, 31264033, 31447673, 31541902, 31677365, 31721310, 31736273, 31847608		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	30008717		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19844129, 19935773, 22005301, 27864285, 28095479, 29288381, 31047104		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	22363778	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	26547706, 29520864, 35190755	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23023190, 26261042, 26830200, 29618473, 30328797, 30389414, 31237437, 31264927		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	23023190	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	19800697, 22226452	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31125917		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	16386239, 16482511, 16751425, 17021762, 17289553, 17606463, 17785829, 18073300, 18164424, 18713787, 18976050, 19534655, 19635858, 19815670, 20536413, 21484795, 22966045, 23579029, 23910013, 24387596, 24547735, 25354400, 25858864, 27043356, 27820809, 27956175, 28074676, 28219892, 28290522, 28395256, 28555647, 28646040, 28850053, 29148561, 29395738, 29403472, 29588152, 29618473, 29899748, 29935220, 29985710, 30258540, 30307322, 30328797, 30458922, 30578016, 31123953, 31154574, 31166866, 31355296, 31484727		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	16751425		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	18587636, 19815670, 21508257, 23327801, 23388728, 24899786, 27149476, 27893410, 29966384, 36171010	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune polyendocrinopathy syndrome, type 1	Autoimmune Polyendocrinopathy	BEFREE	28919897		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	28853491		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28916896, 29328397, 31222746		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	18205865, 18579762, 20375120, 22378604, 25410656, 25439430, 28377641, 29557072		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	18579762		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	22385240, 25410656	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	24749687	Stimulate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30542702		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	24945093	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	1537894		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	36539847	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	30854931	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29328397		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36443508	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	25822228		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	36561744	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	LHGDN	18786233		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	27637385, 31019514, 31507596		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28829805, 29118466, 36482185	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25015728		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	28829805	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31054511	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30542702		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34739724, 40612864	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	28829805		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20603238, 27738346		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28951241, 29074035, 31326395		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	25198673		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	26859134	Associate	★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	29644517, 31003940		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	36439158	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29212740		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23099807, 25434365		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23099807, 25434365		★☆☆☆☆ Found in Text Mining only
Childhood Ganglioglioma	Ganglioglioma	BEFREE	17259542		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	20515574		★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	24040208		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29444977		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19604272		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	24306678		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	25525302	Associate	★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	29961347		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	22174866	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	37373554	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21107311, 22796792, 25838550, 28191009, 28296821, 29085578, 29391156, 30228258, 30232275, 30563755, 31350179, 31358760, 31783404		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	29966384	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23811547, 26698117, 27080861, 28132889, 33730998, 34353876, 35227955, 36881820	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24197332	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis, Collagenous	Colitis	BEFREE	23566938		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25838550, 28191009, 30563755		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	25838550		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18825388, 21547355, 23053983, 24464786, 25015728, 25838550, 26457610, 26559812, 27807862, 28881611, 29808807		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24040001, 25015728, 29690889, 32209656, 32390702	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	22174449		★☆☆☆☆ Found in Text Mining only
Congenital ichthyosis	Congenital Ichthyosis	BEFREE	27554821, 30670307		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	BEFREE	28935206		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30293904		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23023190, 29039526		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23023190		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23023190	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	23023190		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	31729103	Stimulate	★☆☆☆☆ Found in Text Mining only
Costello syndrome (disorder)	Costello syndrome	BEFREE	26138095		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	14605835, 15674109, 17007011, 18497880, 18512248, 18976050, 19333939, 20848455, 21945121, 21994045, 22487796, 23468882, 23575333, 24054330, 24635023, 25809337, 26698117, 28067059, 28411872, 28838416, 29484179, 29593650, 29740348, 29846261, 29848778, 30032288, 30056776, 30060945, 30223688, 30249507, 30271076, 30478416, 30563755, 31052515, 31158699, 31171891, 31321245, 31327402, 31389737, 31435168, 31729183		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	18497880		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	18497880, 19235914, 19249008, 19273624, 22022372, 24635023, 26137941, 27080861, 29556615, 29966384, 30032288, 31052515, 31191543, 31321245, 33037057, 33059618, 34072441, 35227955	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19333939	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	21143945	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	15972674	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	17607545, 30922377		★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	36045687	Associate	★☆☆☆☆ Found in Text Mining only
Darier Disease	Darier disease	Pubtator	37978298	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16772307, 17569750, 18276743, 19900478, 23880957, 24708416		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	30092402		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	16769867, 27893410		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	27893410	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	19380832, 23223134, 24190659, 24345760, 25223230, 27942589, 27964879, 28115058, 28602508, 28658319, 28951241, 28972090, 29474945, 29619073, 29650963, 29759005, 30081696, 30149967, 30166055, 30333830, 30417427, 30926837, 30935778, 31031005, 31062408, 31605740		★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	19785613	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	18981165, 33274957	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	33975024	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	36610660	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	29317264	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	30484527		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	16159888, 23472158, 25223230, 27639070, 27702671, 29122151, 29164954, 30672355, 31793105		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	17021762, 19635858, 23557799, 25789703, 28377495, 30081696, 31070869, 31440261, 31776355		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	24288551, 27803134, 36197661	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23579029, 29569324, 31170010		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23579029, 29569324, 31170010		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	27575603, 30942443	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32962477, 34917685	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34079246	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15603869, 19120275, 23579029, 24434314, 29067979		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24957500, 28757426		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	28454345		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22193967		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	28379971	Stimulate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	11390512		★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	24376306	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28692864		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	31123953		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	16159888, 23472158, 25223230, 27639070, 27702671, 29122151, 29164954, 30672355		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	26166120	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	31707227		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	21392744	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29442466, 29962266		★☆☆☆☆ Found in Text Mining only
Enthesitis	Enthesitis	BEFREE	29846815, 30037432, 30266977		★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	BEFREE	18205865		★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Achalasia	BEFREE	30744559		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	15015579		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23889244	Inhibit	★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	33153894	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	22973830, 30929860, 35570777	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	22687286		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	21751146	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	24114011		★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	17259542		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	30371773		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	17948927, 24069393, 33402994	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	31803999		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	23889244	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	30744559		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	23327801	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	32086386	Stimulate	★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	31697211		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	29731755, 29776658, 30097452		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	29731755, 37703805	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22948536		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21473956		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22752645	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	23792271	Stimulate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30694220, 31139181		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	20016049, 23327801, 25670394		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	23327801, 30814438, 33943012, 35767887	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	32086386	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	16769867, 29331587, 29434217		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	21227898		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	20016049, 29434604, 30814438		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	23090124, 33943012	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	30814438	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	BEFREE	30107066		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23393581		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	8946928		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	21940902	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	21526159	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	33340282	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	21489307	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	37995395	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22851868, 23388728	Associate	★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	30644005		★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	28656364, 30136871, 31075754, 31389737, 31519056		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	19845828	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	30177636		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	31729103	Associate	★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	31440261		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	38301504	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32322161	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27986660		★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	BEFREE	27554821, 30670307		★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	23018857		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	26840075		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	21309737	Inhibit	★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	30700427		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	27893410	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	25025295, 25621490		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	15362668, 30541853		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	21392744	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	15674109, 17068223, 17678845, 18470928, 18976050, 19897957, 20536413, 21227898, 21965815, 22089030, 22375527, 23468882, 23472658, 24382939, 24547735, 25492478, 26019446, 26304966, 26698117, 27670944, 27817215, 28088612, 28190384, 28433688, 28573876, 28792532, 29391156, 29438576, 29441874, 29773890, 29788053, 29897790, 30214568, 30407224, 30425977, 30563755, 30571147, 30612460, 30884245		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17068223, 18470928, 22158873, 23800789, 23811547, 24382939, 25492478, 26083022, 26698117, 27080861, 29966384, 31097538, 31191543, 32474165, 33037057	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	18180107		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	19380832, 23223134, 24190659, 24345760, 25223230, 27942589, 28115058, 28602508, 28650001, 28658319, 28951241, 28972090, 29474945, 29650963, 30081696, 30149967, 30166055, 30417427, 30926837, 31031005, 31062408, 31605740		★☆☆☆☆ Found in Text Mining only
Intervertebral Disk Displacement	Intervertebral Disk Displacement	BEFREE	31537133		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	21547355		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30563755		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	26016922		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	21681782		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	25001461, 30128494		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	24990863		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	36389696	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	1311721	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	9031081, 9639410		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	1311721	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	8946928		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	2787798, 6090008		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	20428758		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23050001, 29928340, 30292634, 30827928, 31054511		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	22727562	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	24375552, 26554784	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29779777		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32209656	Associate	★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	27320770		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	22890025, 28646040		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20334681, 21110900, 24288552, 24433387, 27320770, 27814627, 31861245, 34596026	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	32868411	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28646040		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15941730, 22127978, 22759859, 24990863, 27320770, 28646040, 29430084, 29557072, 30664357, 31004679		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18373953		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	19657089, 29430084, 31002145, 31004679		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	25887118	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28646040		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25015728	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28085013	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	8946928, 9031081		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	22193967		★☆☆☆☆ Found in Text Mining only
Macular dystrophy	Macular dystrophy	BEFREE	29168048		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29328397		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	20428758		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20603238, 27738346		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28325302, 30944648		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29950727		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	28584022		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29574157, 30371773, 30831443		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	26437444		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30542702		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18855579, 20046837, 20536413, 20603238, 21484795, 21547355, 23116756, 23253923, 24292977, 24464786, 26138095, 27738346, 28003381, 28716888, 30563755, 30884245, 31702083		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23099807, 25434365		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25838550, 28191009, 30563755		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	20515574		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	28003381		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21282337, 9622062		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36012688	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30206447, 30858782		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	27893410		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	28951241		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	24376306	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	20718783		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	20718783	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	37506144	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	20395418, 8946928		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16751425, 17003070, 18054783, 18082575, 18403025, 18424480, 23467095, 24547735, 26223651, 27050759, 27893410, 28276258, 28593439, 29074035, 29141810, 29395738, 30917537, 31154574, 31517556		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16751425		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	18054783, 18431321, 25690155, 25780887, 26295034, 27893410, 30917537	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	30554348		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	29405352, 30578016		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	27722177, 9111168		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	27722177	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	8946928		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	29039526		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	19740320	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	26849431, 27166273	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	31332978		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	19430707		★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	31586069		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	31586069		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10208428, 14502230, 16688182, 20671120, 21282337, 21547355, 22408746, 23050001, 23053983, 23250909, 25176343, 25838550, 26437444, 27738346, 27956175, 28716888, 29430789, 29574157, 29704872, 29950727, 30293904, 30483821, 30506430, 30827928, 30944648, 31222746, 31616630, 6090008, 8380100, 9639410		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	19657089, 27814627		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29119640		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	1311721, 2056128	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21691801		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	16769867		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	28951241		★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	28003381		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23116756		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29430084, 29722014		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32188105	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	40429765	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	27836676		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	27062688, 29414600, 30266977		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	29338158		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	26823856, 30714434	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	30714434		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20603238, 27738346		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	14502230, 28325302, 30944648		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22174607	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26191284	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	22174607	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	31748346		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28085013		★☆☆☆☆ Found in Text Mining only
Parakeratosis	Parakeratosis	BEFREE	17074928, 30573271		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22651796, 23046827		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	31507596, 33340282	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	24899786	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	30116153	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	23889244		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	28000855		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	24306678		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34403509	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	23392590	Associate	★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	30107066		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	39768851	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28585716		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	23121980		★☆☆☆☆ Found in Text Mining only
Polyglandular Type I Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	28919897		★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	30119881		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	20671120		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	20671120		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	23910013		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	30119881		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29950727		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33678520, 34755700	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	23528817, 29109267, 29870687, 30149967, 30333830, 31362906, 31375639, 31776355		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	14707118, 17021762, 17074928, 17934500, 18205865, 18408745, 18833071, 19169254, 19380832, 20050849, 20415816, 20480402, 20536413, 20875477, 21317854, 21339218, 23278632, 23291100, 23376980, 23472158, 23563201, 23673284, 23955419, 24419088, 24547735, 24568095, 24679469, 24910175, 24957500, 25156366, 25182136, 25354400, 25537528, 25646481, 25769911, 25789703, 25825452, 26100668, 26170379, 26319047, 27096382, 27686018, 27726924, 27743912, 27984001, 28100093, 28109175, 28165883, 28266782, 28441904, 28602508, 28650001, 28653490, 28658319, 28667777, 28736282, 28770513, 28791896, 28825875, 28853491, 28887948, 28921458, 28951241, 28994166, 29073354, 29103330, 29103334, 29109267, 29130553, 29137840, 29150564, 29232931, 29299984, 29395738, 29420255, 29438576, 29478344, 29482382, 29508278, 29521875, 29535706, 29544684, 29557200, 29588152, 29593650, 29615641, 29619073, 29650963, 29655588, 29663834, 29704872, 29757188, 29759005, 29796240, 29802736, 29893222, 29897790, 29899748, 29926968, 29990694, 30018073, 30019426, 30081696, 30089836, 30143077, 30149967, 30171358, 30174431, 30177636, 30181299, 30196070, 30206447, 30215632, 30307657, 30333830, 30345790, 30394141, 30462554, 30468001, 30500317, 30514663, 30518998, 30578873, 30670307, 30674716, 30858782, 30909615, 30924030, 30926837, 30989239, 31019502, 31031005, 31175175, 31207232, 31250228, 31257614, 31306831, 31326395, 31327402, 31362906, 31384317, 31389737, 31389789, 31424708, 31447673, 31448070, 31454926, 31460804, 31465593, 31465912, 31485004, 31502279, 31578912, 31583255, 31603358, 31721310, 31753191, 31789253, 31793105		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	18981165, 19169254, 19439349, 22298274, 27543964, 28011143, 30246571, 30634937, 30926837, 31129129, 31509228, 31972249, 32962477, 33059618, 33153894, 34001566, 34279540, 34884474, 35297512, 36088336, 36610660, 38174774, 38301504, 40058840	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	LHGDN	19169254		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	19169254, 20953190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	14707118, 25200589, 30417427		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19604272, 33486314, 34079246	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22363778	Stimulate	★☆☆☆☆ Found in Text Mining only
Pustular psoriasis	Pustular Psoriasis	BEFREE	24112799		★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	19169254, 20953190		★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	BEFREE	27743912		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	11117523		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	36012688	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	8502481		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11117523, 16772307, 17569750, 17606463, 17888176, 18276743, 19900478, 20415779, 20840651, 21670317, 22130325, 23880957, 24708416, 25179669, 25354400, 2692124, 26956410, 27820809, 28087506, 28850053, 28898718, 29074035, 29148561, 29490676, 29713730, 30114516, 30805340, 30856393, 31072166, 31161840, 31177017, 31644463, 31830775		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17763202, 18752933		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	19192274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	33382384, 35190755	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	36032502, 36932980	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	20650992, 20659127, 26051272	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27900676		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	19536281	Associate	★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	26722409		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	18227999, 31236002		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	14502230, 22193967		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	17021762		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	LHGDN	17021762		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	19700754, 28743286, 34596026	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	32962477, 34884474, 36672844	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	29148561		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	18205865, 23940256, 26261548, 28339016, 29689250, 29859222, 29977237, 30181299, 30206447, 30743203		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	1537894		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	23508476, 23910729, 28850053, 29438576, 29780803, 29922283, 30038617, 30266977, 30407224, 30700427, 30941119, 31018959, 31729183, 31736273		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	20062062, 23740229, 30208882, 30463609, 30602780, 31530557	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30483821		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36529525	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	20428758		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29574157, 30371773, 30831443		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29118466	Associate	★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	31087753		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	26156866, 33243781	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis, Acne, Pustulosis, Hyperostosis, and Osteitis Syndrome	Synovitis, Acne, Pustulosis, Hyperostosis, and Osteitis (SAPHO) Syndrome	BEFREE	28532819, 31701644		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	17606463, 18713787, 28422002		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29258893		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	26987707, 27989502, 28874185		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	29430084		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	18073300		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28085013	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	26437444		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	28454345		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	26437444, 28454345		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26437444	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	18073300, 30814438, 35767887	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Shock Syndrome	Toxic Shock Syndrome	BEFREE	30817226		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	30542702		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	28678161		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35377948	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	31511910		★☆☆☆☆ Found in Text Mining only
Tyrosine Kinase 2 Deficiency	Tyrosine kinase 2 deficiency	Pubtator	29725107	Stimulate	★☆☆☆☆ Found in Text Mining only
Tyrosine Kinase 2 Deficiency	Tyrosine kinase 2 deficiency	Pubtator	36094518	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	18048021, 18497880, 18976050, 21107311, 21945121, 21994045, 23468882, 24197332, 25497273, 26698117, 28888763, 29085578, 29296188, 29511440, 29644517, 30060945, 30193869, 30563755, 30797423, 31158699, 31760827		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	Pubtator	36539847	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23099807, 23587428	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	18579762		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	LHGDN	18579762		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	25439430		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	31468124		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	37679036	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	24376306	Stimulate	★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	36864213	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	31172649		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	31172649		★☆☆☆☆ Found in Text Mining only