SCLY (selenocysteine lyase)

Gene

• Entrez ID: 51540
• Gene name: Selenocysteine lyase
• Gene symbol: SCLY
• Synonyms (NCBI Gene): SCL, hSCL
• Chromosome: 2
• Chromosome location: 2q37.3
• Summary: Selenocysteine lyase (SCLY; EC 4.4.1.16) catalyzes the pyridoxal 5-prime phosphate-dependent conversion of L-selenocysteine to L-alanine and elemental selenium (Mihara et al., 2000 [PubMed 10692412]).[supplied by OMIM, Mar 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020017	hsa-miR-375	Microarray	20215506
MIRT049587	hsa-miR-92a-3p	qRT-PCR	23622248
MIRT049587	hsa-miR-92a-3p	CLASH	23622248
MIRT041424	hsa-miR-193b-3p	CLASH	23622248
MIRT1329389	hsa-miR-299-3p	CLIP-seq
MIRT1329390	hsa-miR-3647-3p	CLIP-seq
MIRT1329391	hsa-miR-3662	CLIP-seq
MIRT1329392	hsa-miR-4252	CLIP-seq
MIRT1329393	hsa-miR-4265	CLIP-seq
MIRT1329394	hsa-miR-4296	CLIP-seq
MIRT1329395	hsa-miR-4322	CLIP-seq
MIRT1329396	hsa-miR-4417	CLIP-seq
MIRT1329397	hsa-miR-4488	CLIP-seq
MIRT1329398	hsa-miR-4505	CLIP-seq
MIRT1329399	hsa-miR-4697-5p	CLIP-seq
MIRT1329400	hsa-miR-4731-5p	CLIP-seq
MIRT1329401	hsa-miR-4746-5p	CLIP-seq
MIRT1329402	hsa-miR-485-5p	CLIP-seq
MIRT1329403	hsa-miR-637	CLIP-seq
MIRT2097686	hsa-miR-31	CLIP-seq
MIRT2097687	hsa-miR-3128	CLIP-seq
MIRT2097688	hsa-miR-4253	CLIP-seq
MIRT2097689	hsa-miR-4651	CLIP-seq
MIRT2097690	hsa-miR-4698	CLIP-seq
MIRT2097691	hsa-miR-4720-5p	CLIP-seq
MIRT2097692	hsa-miR-4793-5p	CLIP-seq
MIRT2097693	hsa-miR-4799-3p	CLIP-seq
MIRT2097694	hsa-miR-608	CLIP-seq
MIRT1329403	hsa-miR-637	CLIP-seq
MIRT2321948	hsa-miR-342-5p	CLIP-seq
MIRT2321949	hsa-miR-3664-3p	CLIP-seq
MIRT2321950	hsa-miR-4433	CLIP-seq
MIRT2321951	hsa-miR-4459	CLIP-seq
MIRT2321952	hsa-miR-4471	CLIP-seq
MIRT2321953	hsa-miR-4496	CLIP-seq
MIRT2321954	hsa-miR-4664-5p	CLIP-seq
MIRT2321955	hsa-miR-4687-5p	CLIP-seq
MIRT2321956	hsa-miR-4738-3p	CLIP-seq
MIRT2321957	hsa-miR-4768-3p	CLIP-seq
MIRT2321958	hsa-miR-4779	CLIP-seq
MIRT1329403	hsa-miR-637	CLIP-seq
MIRT2618381	hsa-miR-125a-5p	CLIP-seq
MIRT2618382	hsa-miR-125b	CLIP-seq
MIRT2618383	hsa-miR-4319	CLIP-seq
MIRT2618384	hsa-miR-4424	CLIP-seq
MIRT2618385	hsa-miR-4682	CLIP-seq
MIRT2618381	hsa-miR-125a-5p	CLIP-seq
MIRT2618382	hsa-miR-125b	CLIP-seq
MIRT2618383	hsa-miR-4319	CLIP-seq
MIRT2618384	hsa-miR-4424	CLIP-seq
MIRT2690247	hsa-miR-4475	CLIP-seq
MIRT2618385	hsa-miR-4682	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21044950, 21516116, 29892012, 31515488
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS	10692412
GO:0006520	Process	Amino acid metabolic process	TAS	10692412
GO:0009000	Function	Selenocysteine lyase activity	IEA
GO:0009000	Function	Selenocysteine lyase activity	TAS	10692412
GO:0016261	Process	Selenocysteine catabolic process	IEA
GO:0016597	Function	Amino acid binding	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0070279	Function	Vitamin B6 binding	IEA
GO:1902494	Component	Catalytic complex	IEA

Other IDs

• MIM: 611056
• HGNC: 18161
• e!Ensembl: ENSG00000132330

Protein

• UniProt ID: Q96I15
• Protein name: Selenocysteine lyase (hSCL) (EC 4.4.1.16)
• Protein function: Catalyzes the decomposition of L-selenocysteine to L-alanine and elemental selenium.
• PDB: 3GZC, 3GZD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00266	Aminotran_5	32 → 430	Aminotransferase class-V	Domain

• Sequence:

  MEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGN
  PSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFHANQTS
  KGHTGGHHSPVKGAKPHFITSSVEHDSIRLPLEHLVEEQVAAVTFVPVSKVSGQAEVDDI
  LAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNQERVAAGLPPILVHTDAAQALGK
  QRVDVEDLGVDFLTIVGHKFYGPRIGALYIRGLGEFTPLYPMLFGGGQERNFRPGTENTP
  MIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNSQFPGTQRLPNTCN
  FSIRGPRLQGHVVLAQCRVLMASVGAACHSDHGDQPSPVLLSYGVPFDVARNALRLSVGR
  STTRAEVDLVVQDLKQAVAQLEDQA

• Sequence length: 445

Pathways

KEGG:

Selenocompound metabolism
Metabolic pathways

Reactome:

Metabolism of ingested SeMet, Sec, MeSec into H2Se

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	10688671, 1756722, 30185409		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12580964, 7579412		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	11390401, 1311214, 14513050, 2467296, 2602361, 28179281		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	7579412		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	7672800, 9931488		★☆☆☆☆ Found in Text Mining only
Agoraphobia	Agoraphobia	BEFREE	28167838, 30546323		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	31747876		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29303699		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	28948079, 29455021, 29879886, 30062717		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	10483055, 10994648, 17210818, 1827639, 20064128, 27807927, 28328110, 28606893, 28707502, 28712415, 29038686, 29045499, 29057552, 29246564, 29344846, 29434563, 29546787, 29621675, 29902667, 29908386, 29922611, 30127753, 30546323, 30689871, 30946774, 31043102, 31254963, 31378654, 31400561, 31543838, 31665694		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	10483055, 10994648, 17210818, 1827639, 20064128, 27807927, 28328110, 28606893, 28707502, 28712415, 29038686, 29045499, 29057552, 29246564, 29344846, 29434563, 29546787, 29621675, 29902667, 29908386, 29922611, 30127753, 30546323, 30689871, 30946774, 31043102, 31254963, 31378654, 31400561, 31543838, 31665694		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	11328281		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	14693349		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10607488		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	29362929, 29475216		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31275179		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	31275179		★☆☆☆☆ Found in Text Mining only
Bedwetting	Nocturnal enuresis	BEFREE	27665376		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	28948079, 29455021, 29879886, 31695652		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17426052		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29303699		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30138228		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	7579412		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	1402676		★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	BEFREE	28626162		★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	27418012		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	15842033, 17210818, 20064128, 20494447, 21531467, 21835094, 27807927, 28028732, 28328110, 28606893, 28707502, 29038686, 29045499, 29092782, 29111383, 29156358, 29168066, 29179911, 29220120, 29246564, 2934456, 29434563, 29546787, 29621675, 29902667, 29908386, 30089466, 30127753, 30472336, 30689871, 30791342, 30946774, 30961347, 30999796, 31041626, 31043102, 31088419, 31254963, 31354542, 31434343, 31463614, 31665694		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28659632		★☆☆☆☆ Found in Text Mining only
Disruptive Behavior Disorder	Disruptive Behavior Disorder	BEFREE	28456023		★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	28558358		★☆☆☆☆ Found in Text Mining only
Disturbance in mood	Mood Disorder	BEFREE	31043102		★☆☆☆☆ Found in Text Mining only
Dysautonomia, Familial	Dysautonomia	BEFREE	29776354		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	31717805		★☆☆☆☆ Found in Text Mining only
Dysmorphism	Dysmorphism	BEFREE	28646788		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	23775054, 28456023, 29179911, 29626825, 29846016, 29879886, 30977532, 31695652, 3346203		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	28836553		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	29455021		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	29353492		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	29384872, 30345782		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	23271126		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	10360508		★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	10360508		★☆☆☆☆ Found in Text Mining only
Hereditary Motor and Sensory Neuropathies	Hereditary motor and sensory neuropathy	BEFREE	22329956		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	17210818, 17481592, 24374998		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31717805		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	10607488		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28553720		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30689871		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	24428240		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	30548357		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10498694, 1375001, 7579412, 8035609, 8414511, 8673726, 9230693		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	7579412, 8035609, 9031072		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11243382, 1964581		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16925092		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	10607488		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	8547631		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11243382, 1387813, 22334400, 29643827, 9171354		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	1625484		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	15842033, 17210818, 20064128, 20494447, 21531467, 21835094, 27807927, 28028732, 28328110, 28606893, 28707502, 29038686, 29045499, 29092782, 29111383, 29156358, 29168066, 29179911, 29220120, 29246564, 2934456, 29434563, 29546787, 29621675, 29902667, 29908386, 30089466, 30127753, 30472336, 30689871, 30791342, 30946774, 30961347, 30999796, 31043102, 31088419, 31254963, 31354542, 31434343, 31463614, 31665694		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	24428240, 29186861, 29246564, 30065872		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	24428240		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31340540		★☆☆☆☆ Found in Text Mining only
Mild depression	Mental Depression	BEFREE	2934456		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	10994648, 29100973, 29714082, 29776354, 29846016		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	14513050		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	1625484		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	31018977, 7579412		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11243382, 1625484		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	24374998, 28648138		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30472336, 31665694		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28506319, 31340540, 31717805, 9118359		★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	BEFREE	17481592		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	28885070, 30689871		★☆☆☆☆ Found in Text Mining only
Oppositional Defiant Disorder	Oppositional Defiant Disorder	BEFREE	31681713		★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	BEFREE	28345374, 28551488		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	28167838, 28551488		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29100973, 30017779		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	30017779		★☆☆☆☆ Found in Text Mining only
Phobic anxiety disorder	Phobic Anxiety Disorder	BEFREE	10994648, 24374998, 28551488, 29922611, 30017779, 30472336		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	24377512		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28834884, 28871848, 29038686, 30220982, 30791342, 31041626		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	9171354		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10688671, 11243382, 12531481, 1311214, 1382561, 1402676, 1450410, 15198727, 1625484, 16621969, 17429429, 1922059, 20855495, 23698277, 23857984, 28028313, 29654272, 7672800, 7744799, 7824274, 7833471, 8167548, 8673726, 9171354, 9416841		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30713334		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	30472336, 31665694		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	14693349		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	14693349		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	10607488		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	18624760, 24377512, 26902922, 27907906, 30738056		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	10607488, 9543562		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	29019477		★☆☆☆☆ Found in Text Mining only
Thymus Neoplasms	Thymus Neoplasms	BEFREE	17429429		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30017593		★☆☆☆☆ Found in Text Mining only