Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51531
Gene name	TRNA methyltransferase O
Gene symbol	TRMO
Synonyms (NCBI Gene)	C9orf156HSPC219NAP1
Chromosome	9
Chromosome location	9q22.33

Show/Hide all (74)

miRTarBase ID	miRNA	Experiments	Reference
MIRT515976	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT515975	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT515974	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT515973	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT515971	hsa-miR-134-5p	HITS-CLIP	21572407
MIRT515970	hsa-miR-3118	HITS-CLIP	21572407
MIRT515969	hsa-miR-3164	HITS-CLIP	21572407
MIRT515968	hsa-miR-6820-3p	HITS-CLIP	21572407
MIRT550632	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT515967	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT515966	hsa-miR-6818-5p	HITS-CLIP	21572407
MIRT682874	hsa-miR-1276	HITS-CLIP	23706177
MIRT682873	hsa-miR-4432	HITS-CLIP	23706177
MIRT682872	hsa-miR-508-5p	HITS-CLIP	23706177
MIRT682871	hsa-miR-451b	HITS-CLIP	23706177
MIRT682870	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT682869	hsa-miR-939-3p	HITS-CLIP	23706177
MIRT682868	hsa-miR-766-3p	HITS-CLIP	23706177
MIRT682867	hsa-miR-4486	HITS-CLIP	23706177
MIRT682866	hsa-miR-4696	HITS-CLIP	23706177
MIRT682865	hsa-miR-661	HITS-CLIP	23706177
MIRT682864	hsa-miR-4649-5p	HITS-CLIP	23706177
MIRT682863	hsa-miR-6729-5p	HITS-CLIP	23706177
MIRT682862	hsa-miR-6512-3p	HITS-CLIP	23706177
MIRT682861	hsa-miR-6720-5p	HITS-CLIP	23706177
MIRT682860	hsa-miR-7703	HITS-CLIP	23706177
MIRT515976	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT515975	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT515974	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT515973	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT515971	hsa-miR-134-5p	PAR-CLIP	21572407
MIRT515970	hsa-miR-3118	PAR-CLIP	21572407
MIRT515969	hsa-miR-3164	PAR-CLIP	21572407
MIRT515968	hsa-miR-6820-3p	PAR-CLIP	21572407
MIRT550632	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT515967	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT515966	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT515976	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT515975	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT515974	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT515973	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT515972	hsa-miR-16-1-3p	PAR-CLIP	23446348
MIRT515971	hsa-miR-134-5p	PAR-CLIP	23446348
MIRT515970	hsa-miR-3118	PAR-CLIP	23446348
MIRT515969	hsa-miR-3164	PAR-CLIP	23446348
MIRT515968	hsa-miR-6820-3p	PAR-CLIP	23446348
MIRT515967	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT515966	hsa-miR-6818-5p	PAR-CLIP	23446348
MIRT515965	hsa-miR-562	PAR-CLIP	23446348
MIRT515964	hsa-miR-3929	PAR-CLIP	23446348
MIRT515963	hsa-miR-4419b	PAR-CLIP	23446348
MIRT515962	hsa-miR-4478	PAR-CLIP	23446348
MIRT515961	hsa-miR-296-3p	PAR-CLIP	23446348
MIRT515960	hsa-miR-4781-3p	PAR-CLIP	23446348
MIRT515959	hsa-miR-4716-5p	PAR-CLIP	23446348
MIRT515958	hsa-let-7a-5p	PAR-CLIP	23446348
MIRT515957	hsa-let-7b-5p	PAR-CLIP	23446348
MIRT515956	hsa-let-7c-5p	PAR-CLIP	23446348
MIRT515955	hsa-let-7d-5p	PAR-CLIP	23446348
MIRT515954	hsa-let-7e-5p	PAR-CLIP	23446348
MIRT515953	hsa-let-7f-5p	PAR-CLIP	23446348
MIRT515952	hsa-let-7g-5p	PAR-CLIP	23446348
MIRT515951	hsa-let-7i-5p	PAR-CLIP	23446348
MIRT515950	hsa-miR-4458	PAR-CLIP	23446348
MIRT515949	hsa-miR-4500	PAR-CLIP	23446348
MIRT515948	hsa-miR-98-5p	PAR-CLIP	23446348
MIRT515947	hsa-miR-4755-3p	PAR-CLIP	23446348
MIRT515946	hsa-miR-197-3p	PAR-CLIP	23446348
MIRT515945	hsa-miR-548s	PAR-CLIP	23446348
MIRT515944	hsa-miR-4701-5p	PAR-CLIP	23446348
MIRT515943	hsa-miR-588	PAR-CLIP	23446348
MIRT515942	hsa-miR-4435	PAR-CLIP	23446348
MIRT515941	hsa-miR-3187-3p	PAR-CLIP	23446348
MIRT515939	hsa-miR-5096	PAR-CLIP	23446348

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0008033	Process	TRNA processing	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030488	Process	TRNA methylation	IDA	25063302
GO:0032259	Process	Methylation	IEA
GO:0089715	Function	TRNA (L-threonylcarbamoyladenosine(37)-C2) methyltransferase activity	IDA	25063302
GO:0089715	Function	TRNA (L-threonylcarbamoyladenosine(37)-C2) methyltransferase activity	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9BU70

Protein name

tRNA (adenine(37)-N6)-methyltransferase (EC 2.1.1.-) (tRNA methyltransferase O)

Protein function

S-adenosyl-L-methionine-dependent methyltransferase responsible for the addition of the methyl group in the formation of N6-methyl-N6-threonylcarbamoyladenosine at position 37 (m(6)t(6)A37) of the tRNA anticodon loop of tRNA(Ser)(GCU) (PubMed:25

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01980	TrmO	45 → 164	tRNA-methyltransferase O	Family

Sequence

MRGLEESGPRPTATPCGCVKPALETGNLLTEPVGYLESCFSAKNGTPRQPSICSYSRACL
RIRKRIFNNPEHSLMGLEQFSHVWILFVFHKNGHLSCKAKVQPPRLNGAKTGVFSTRSPH
RPNAIGLTLAKLEKVEGGAIYLSGIDMIHGTPVLDIKPYIAEYDSPQNVMEPLADFNLQN
NQHTPNTVSQSDSKTDSCDQRQLSGCDEPQPHHSTKRKPKCPEDRTSEENYLTHSDTARI
QQAFPMHREIAVDFGLESRRDQSSSVAEEQIGPYCPEKSFSEKGTDKKLERVEGAAVLQG
SRAETQPMAPHCPAGRADGAPRSVVPAWVTEAPVATLEVRFTPHAEMDLGQLSSQDVGQA
SFKYFQSAEEAKRAIEAVLSADPRSVYRRKLCQDRLFYFTVDIAHVTCWFGDGFAEVLRI
KPASEPVHMTGPVGSLVSLGS

Sequence length

441

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFERENTIATED THYROID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAPILLARY THYROID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	18216211, 19081526, 19755166, 21487764, 24213847, 25782900, 28125650, 28501926, 28645479, 29174729, 29846557, 30052178, 30170546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	23286385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20943860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30867003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	1711550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thiel-Behnke corneal dystrophy	Thiel-Behnke Corneal Dystrophy	BEFREE	28125650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	27207655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	33903625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TRMO (tRNA methyltransferase O)