Gene Gene information from NCBI Gene database.
Entrez ID 5153
Gene name Phosphodiesterase 1B
Gene symbol PDE1B
Synonyms (NCBI Gene)
HEL-S-79pPDE1B1PDES1B
Chromosome 12
Chromosome location 12q13.2
Summary The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specifici
miRNA miRNA information provided by mirtarbase database.
80
miRTarBase ID miRNA Experiments Reference
MIRT725251 hsa-miR-6504-5p HITS-CLIP 19536157
MIRT725250 hsa-miR-3064-5p HITS-CLIP 19536157
MIRT725249 hsa-miR-149-5p HITS-CLIP 19536157
MIRT725248 hsa-miR-326 HITS-CLIP 19536157
MIRT725247 hsa-miR-330-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0001975 Process Response to amphetamine IEA
GO:0004112 Function Cyclic-nucleotide phosphodiesterase activity IEA
GO:0004114 Function 3',5'-cyclic-nucleotide phosphodiesterase activity IEA
GO:0004115 Function 3',5'-cyclic-AMP phosphodiesterase activity IDA 14687666
GO:0004115 Function 3',5'-cyclic-AMP phosphodiesterase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
171891 8775 ENSG00000123360
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q01064
Protein name Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B (Cam-PDE 1B) (EC 3.1.4.17) (63 kDa Cam-PDE)
Protein function Cyclic nucleotide phosphodiesterase with a dual specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes (PubMed:15260978, PubMed:8855339, PubMed:9419816). Has a preference for cGMP
PDB 1TAZ , 4NPV , 4NPW , 5B25 , 5UOY , 5UP0 , 5W6E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08499 PDEase_I_N 77 137 Family
PF00233 PDEase_I 222 450 Domain
Sequence
MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNL
EYTASLLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKP
KFRSIVHAVQAGIFVER
MFRRTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAADDHAL
RTIVFELLTRHNLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLL
RTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKSECAIVYNDRSVLENHHISSV
FRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPK
ALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS
QIGFIDFIVEPTFSVLTDVAEKSVQPLADE
DSKSKNQPSFQWRQPSLDVEVGDPNPDVVS
FRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
Sequence length 536
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Purine metabolism
Metabolic pathways
Calcium signaling pathway
Olfactory transduction
Taste transduction
Renin secretion
Morphine addiction
  Cam-PDE 1 activation
cGMP effects
G alpha (s) signalling events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
8
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Cerebellar ataxia Uncertain significance ClinVar
Disgenet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Delayed speech and language development Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hypotonia Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adult Learning Disorders Learning Disorders CTD_human_DG 12077213
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 24743702 Associate
★☆☆☆☆
Found in Text Mining only
Chronic Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 9746789
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 34497681 Associate
★☆☆☆☆
Found in Text Mining only
Depressive disorder Mental Depression PSYGENET_DG 17559891
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Depressive disorder Mental Depression BEFREE 28337525, 28488329
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Huntington Disease Huntington Disease BEFREE 14751289
★☆☆☆☆
Found in Text Mining only
Learning Disabilities Learning Disorders CTD_human_DG 12077213
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Learning Disorders Learning Disorders CTD_human_DG 12077213
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Learning Disturbance Learning Disorders CTD_human_DG 12077213
★☆☆☆☆
Found in Text Mining only