Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51527
Gene name	GSK3B interacting protein
Gene symbol	GSKIP
Synonyms (NCBI Gene)	C14orf129HSPC210
Chromosome	14
Chromosome location	14q32.2
Summary	This gene encodes a protein that is involved as a negative regulator of GSK3-beta in the Wnt signaling pathway. The encoded protein may play a role in the retinoic acid signaling pathway by regulating the functional interactions between GSK3-beta, beta-ca

Show/Hide all (40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT559864	hsa-miR-548ac	PAR-CLIP	20371350
MIRT559863	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT559862	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT559861	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT559860	hsa-miR-548z	PAR-CLIP	20371350
MIRT559859	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT559858	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT559857	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT559856	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT559855	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT559854	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT559853	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT559852	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT559851	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT559850	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT559849	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT559847	hsa-miR-6079	PAR-CLIP	20371350
MIRT728158	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT728157	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT728156	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT728154	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT728155	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT728153	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT559864	hsa-miR-548ac	PAR-CLIP	20371350
MIRT559863	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT559862	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT559861	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT559860	hsa-miR-548z	PAR-CLIP	20371350
MIRT559859	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT559858	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT559857	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT559856	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT559855	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT559854	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT559853	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT559852	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT559851	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT559850	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT559849	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT559847	hsa-miR-6079	PAR-CLIP	20371350

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004860	Function	Protein kinase inhibitor activity	IDA	19830702
GO:0004860	Function	Protein kinase inhibitor activity	IMP	16981698
GO:0005515	Function	Protein binding	IPI	20007971, 20368287, 23602568, 25920809, 27484798, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	20007971
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16981698, 20007971
GO:0005737	Component	Cytoplasm	IEA
GO:0006469	Process	Negative regulation of protein kinase activity	IMP	16981698
GO:0008013	Function	Beta-catenin binding	IDA	27484798
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IMP	25920809
GO:0019207	Function	Kinase regulator activity	IBA
GO:0019901	Function	Protein kinase binding	IPI	16981698
GO:0030111	Process	Regulation of Wnt signaling pathway	IBA
GO:0030111	Process	Regulation of Wnt signaling pathway	IMP	16981698
GO:0034237	Function	Protein kinase A regulatory subunit binding	IPI	27484798
GO:0051018	Function	Protein kinase A binding	IBA
GO:0051018	Function	Protein kinase A binding	IPI	20007971, 25920809
GO:0060828	Process	Regulation of canonical Wnt signaling pathway	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IDA	27484798

MIM	HGNC	e!Ensembl
616605	20343	ENSG00000100744

Q9P0R6

Protein name

GSK3B-interacting protein (GSKIP) (GSK3beta interaction protein)

Protein function

A-kinase anchoring protein for GSK3B and PKA that regulates or facilitates their kinase activity towards their targets (PubMed:16981698, PubMed:25920809, PubMed:27484798). The ternary complex enhances Wnt-induced signaling by facilitating the GS

PDB

1SGO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05303	DUF727	33 → 133	Protein of unknown function (DUF727)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in heart, brain, placenta, liver, skeletal muscle, kidney, testis, lung and pancreas. {ECO:0000269|PubMed:16981698}.

Sequence

METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCA
DDVAYINVETKERNRYCLELTEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYRE
AFGNALLQRLEALKRDGQS

Sequence length

139

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GSKIP-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELOPROLIFERATIVE DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinogenesis	Carcinogenesis	Pubtator	36550871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27484798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Monocytic, Chronic	Monocytic Leukemia	CTD_human_DG	26280900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29055955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26280900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	36550871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	CTD_human_DG	26280900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	CTD_human_DG	26280900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	27484798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GSKIP (GSK3B interacting protein)