CXXC5 (CXXC finger protein 5)

Gene

• Entrez ID: 51523
• Gene name: CXXC finger protein 5
• Gene symbol: CXXC5
• Synonyms (NCBI Gene): CF5, HSPC195, RINF, WID
• Chromosome: 5
• Chromosome location: 5q31.2
• Summary: The protein encoded by this gene is a retinoid-inducible nuclear protein containing a CXXC-type zinc finger motif. The encoded protein is involved in myelopoiesis, is required for DNA damage-induced p53 activation, regulates the differentiation of C2C12 m

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021344	hsa-miR-9-5p	Microarray	17612493
MIRT043013	hsa-miR-324-3p	CLASH	23622248
MIRT659224	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT659223	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT659222	hsa-miR-1470	HITS-CLIP	23824327
MIRT659221	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT659220	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT659219	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT659218	hsa-miR-4469	HITS-CLIP	23824327
MIRT659217	hsa-miR-548q	HITS-CLIP	23824327
MIRT659216	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT659215	hsa-miR-4679	HITS-CLIP	23824327
MIRT659214	hsa-miR-3182	HITS-CLIP	23824327
MIRT659213	hsa-miR-7106-3p	HITS-CLIP	23824327
MIRT659212	hsa-miR-3907	HITS-CLIP	23824327
MIRT659224	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT659223	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT659222	hsa-miR-1470	HITS-CLIP	23824327
MIRT659221	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT659220	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT659219	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT659218	hsa-miR-4469	HITS-CLIP	23824327
MIRT659217	hsa-miR-548q	HITS-CLIP	23824327
MIRT659216	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT659215	hsa-miR-4679	HITS-CLIP	23824327
MIRT659214	hsa-miR-3182	HITS-CLIP	23824327
MIRT659213	hsa-miR-7106-3p	HITS-CLIP	23824327
MIRT659212	hsa-miR-3907	HITS-CLIP	23824327
MIRT918905	hsa-miR-25	CLIP-seq
MIRT918906	hsa-miR-3177-3p	CLIP-seq
MIRT918907	hsa-miR-32	CLIP-seq
MIRT918908	hsa-miR-3616-3p	CLIP-seq
MIRT918909	hsa-miR-363	CLIP-seq
MIRT918910	hsa-miR-367	CLIP-seq
MIRT918911	hsa-miR-3940-5p	CLIP-seq
MIRT918912	hsa-miR-4436b-3p	CLIP-seq
MIRT918913	hsa-miR-4507	CLIP-seq
MIRT918914	hsa-miR-4519	CLIP-seq
MIRT918915	hsa-miR-92a	CLIP-seq
MIRT918916	hsa-miR-92b	CLIP-seq
MIRT1972280	hsa-miR-1287	CLIP-seq
MIRT1972281	hsa-miR-188-5p	CLIP-seq
MIRT918905	hsa-miR-25	CLIP-seq
MIRT1972282	hsa-miR-3135b	CLIP-seq
MIRT918906	hsa-miR-3177-3p	CLIP-seq
MIRT918907	hsa-miR-32	CLIP-seq
MIRT918908	hsa-miR-3616-3p	CLIP-seq
MIRT918909	hsa-miR-363	CLIP-seq
MIRT918910	hsa-miR-367	CLIP-seq
MIRT918912	hsa-miR-4436b-3p	CLIP-seq
MIRT918914	hsa-miR-4519	CLIP-seq
MIRT1972283	hsa-miR-4780	CLIP-seq
MIRT1972284	hsa-miR-4786-5p	CLIP-seq
MIRT1972285	hsa-miR-623	CLIP-seq
MIRT918915	hsa-miR-92a	CLIP-seq
MIRT918916	hsa-miR-92b	CLIP-seq
MIRT1972280	hsa-miR-1287	CLIP-seq
MIRT1972281	hsa-miR-188-5p	CLIP-seq
MIRT1972282	hsa-miR-3135b	CLIP-seq
MIRT918914	hsa-miR-4519	CLIP-seq
MIRT1972283	hsa-miR-4780	CLIP-seq
MIRT1972284	hsa-miR-4786-5p	CLIP-seq
MIRT1972285	hsa-miR-623	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
WT1	Activation	20220130

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	23303788
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0008270	Function	Zinc ion binding	IDA	29276034
GO:0008270	Function	Zinc ion binding	IEA
GO:0008327	Function	Methyl-CpG binding	IBA
GO:0008327	Function	Methyl-CpG binding	IDA	29276034
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:0043467	Process	Regulation of generation of precursor metabolites and energy	IDA	23303788
GO:0043565	Function	Sequence-specific DNA binding	IDA	23303788
GO:0046872	Function	Metal ion binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IDA	23303788

Other IDs

• MIM: 612752
• HGNC: 26943
• e!Ensembl: ENSG00000171604

Protein

• UniProt ID: Q7LFL8
• Protein name: CXXC-type zinc finger protein 5 (CF5) (Putative MAPK-activating protein PM08) (Putative NF-kappa-B-activating protein 102) (Retinoid-inducible nuclear factor) (RINF)
• Protein function: May indirectly participate in activation of the NF-kappa-B and MAPK pathways. Acts as a mediator of BMP4-mediated modulation of canonical Wnt signaling activity in neural stem cells (By similarity). Required for DNA damage-induced ATM phosphoryl
• PDB: 5W9S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02008	zf-CXXC	255 → 296	CXXC zinc finger domain	Domain

• Sequence:

  MSSLGGGSQDAGGSSSSSTNGSGGSGSSGPKAGAADKSAVVAAAAPASVADDTPPPERRN
  KSGIISEPLNKSLRRSRPLSHYSSFGSSGGSGGGSMMGGESADKATAAAAAASLLANGHD
  LAAAMAVDKSNPTSKHKSGAVASLLSKAERATELAAEGQLTLQQFAQSTEMLKRVVQEHL
  PLMSEAGAGLPDMEAVAGAEALNGQSDFPYLGAFPINPGLFIMTPAGVFLAESALHMAGL
  AEYPMQGELASAISSGKKKRKRCGMCAPCRRRINCEQCSSCRNRKTGHQICKFRKCEELK
  KKPSAALEKVMLPTGAAFRWFQ

• Sequence length: 322

Pathways

Reactome:

Estrogen-dependent gene expression

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	19182210, 25805812		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	28595998		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	29027288	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21325450, 29928427, 30386679		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21325450, 36539038	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29027288	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	19182210, 25805812		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	36539038	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19182210	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25805812	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	19182210	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	21325450	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19182210, 25805812	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23988457, 25605239	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	19182210	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19182210, 23988457, 25605239, 25805812		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29036306, 29780166		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21325450, 29928427, 30386679		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29027288		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28184940		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21325450		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29928427		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28067315		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21325450, 29027288		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21325450		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29027288	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	19182210		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	19182210, 21325450		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	19182210	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	19388938	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19182210, 21325450, 25605239, 29036306, 30386679		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	19182210	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29928427		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	27932247, 29627878		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	22246450	Inhibit	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21325450, 29027288		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29027288		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	29027288	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29027288	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31682594	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28184940		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	29027288	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21325450		★☆☆☆☆ Found in Text Mining only