Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51514
Gene name	Denticleless E3 ubiquitin protein ligase adapter
Gene symbol	DTL
Synonyms (NCBI Gene)	CDT2DCAF2L2DTLRAMP
Chromosome	1
Chromosome location	1q32.3

139

Show/Hide all (139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004848	hsa-miR-192-5p	Luciferase reporter assayqRT-PCR	19074876
MIRT006563	hsa-miR-30a-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	22287560
MIRT006563	hsa-miR-30a-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	22287560
MIRT006563	hsa-miR-30a-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	22287560
MIRT006563	hsa-miR-30a-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	22287560
MIRT024273	hsa-miR-215-5p	Microarray	19074876
MIRT004848	hsa-miR-192-5p	Reporter assay;Microarray;Other	19074876
MIRT030300	hsa-miR-26b-5p	Microarray	19088304
MIRT030601	hsa-miR-24-3p	Microarray	19748357
MIRT049694	hsa-miR-92a-3p	CLASH	23622248
MIRT755968	hsa-miR-96-5p	Luciferase reporter assayWestern blottingqRT-PCR	38133379
MIRT946588	hsa-miR-1179	CLIP-seq
MIRT946589	hsa-miR-1207-5p	CLIP-seq
MIRT946590	hsa-miR-1266	CLIP-seq
MIRT946591	hsa-miR-1284	CLIP-seq
MIRT946592	hsa-miR-137	CLIP-seq
MIRT946593	hsa-miR-141	CLIP-seq
MIRT946594	hsa-miR-193a-3p	CLIP-seq
MIRT946595	hsa-miR-193b	CLIP-seq
MIRT946596	hsa-miR-200a	CLIP-seq
MIRT946597	hsa-miR-217	CLIP-seq
MIRT946598	hsa-miR-23a	CLIP-seq
MIRT946599	hsa-miR-23b	CLIP-seq
MIRT946600	hsa-miR-23c	CLIP-seq
MIRT946601	hsa-miR-24	CLIP-seq
MIRT946602	hsa-miR-2682	CLIP-seq
MIRT946603	hsa-miR-3124-3p	CLIP-seq
MIRT946604	hsa-miR-3127-5p	CLIP-seq
MIRT946605	hsa-miR-3140-3p	CLIP-seq
MIRT946606	hsa-miR-3200-5p	CLIP-seq
MIRT946607	hsa-miR-323-3p	CLIP-seq
MIRT946608	hsa-miR-331-5p	CLIP-seq
MIRT946609	hsa-miR-34c-3p	CLIP-seq
MIRT946610	hsa-miR-3545-3p	CLIP-seq
MIRT946611	hsa-miR-3658	CLIP-seq
MIRT946612	hsa-miR-3660	CLIP-seq
MIRT946613	hsa-miR-3685	CLIP-seq
MIRT946614	hsa-miR-3691-3p	CLIP-seq
MIRT946615	hsa-miR-376c	CLIP-seq
MIRT946616	hsa-miR-380	CLIP-seq
MIRT946617	hsa-miR-384	CLIP-seq
MIRT946618	hsa-miR-3918	CLIP-seq
MIRT946619	hsa-miR-3936	CLIP-seq
MIRT946620	hsa-miR-3941	CLIP-seq
MIRT946621	hsa-miR-3973	CLIP-seq
MIRT946622	hsa-miR-411	CLIP-seq
MIRT946623	hsa-miR-4284	CLIP-seq
MIRT946624	hsa-miR-4303	CLIP-seq
MIRT946625	hsa-miR-4307	CLIP-seq
MIRT946626	hsa-miR-4310	CLIP-seq
MIRT946627	hsa-miR-4420	CLIP-seq
MIRT946628	hsa-miR-4423-3p	CLIP-seq
MIRT946629	hsa-miR-4477a	CLIP-seq
MIRT946630	hsa-miR-448	CLIP-seq
MIRT946631	hsa-miR-4495	CLIP-seq
MIRT946632	hsa-miR-449c	CLIP-seq
MIRT946633	hsa-miR-4502	CLIP-seq
MIRT946634	hsa-miR-450b-5p	CLIP-seq
MIRT946635	hsa-miR-4514	CLIP-seq
MIRT946636	hsa-miR-4518	CLIP-seq
MIRT946637	hsa-miR-4526	CLIP-seq
MIRT946638	hsa-miR-4539	CLIP-seq
MIRT946639	hsa-miR-4639-3p	CLIP-seq
MIRT946640	hsa-miR-4643	CLIP-seq
MIRT946641	hsa-miR-4652-3p	CLIP-seq
MIRT946642	hsa-miR-466	CLIP-seq
MIRT946643	hsa-miR-4661-5p	CLIP-seq
MIRT946644	hsa-miR-4662a-3p	CLIP-seq
MIRT946645	hsa-miR-4668-3p	CLIP-seq
MIRT946646	hsa-miR-4672	CLIP-seq
MIRT946647	hsa-miR-4692	CLIP-seq
MIRT946648	hsa-miR-4724-5p	CLIP-seq
MIRT946649	hsa-miR-4728-5p	CLIP-seq
MIRT946650	hsa-miR-4729	CLIP-seq
MIRT946651	hsa-miR-4742-3p	CLIP-seq
MIRT946652	hsa-miR-4763-3p	CLIP-seq
MIRT946653	hsa-miR-4778-5p	CLIP-seq
MIRT946654	hsa-miR-4789-3p	CLIP-seq
MIRT946655	hsa-miR-4789-5p	CLIP-seq
MIRT946656	hsa-miR-4793-5p	CLIP-seq
MIRT946657	hsa-miR-4795-3p	CLIP-seq
MIRT946658	hsa-miR-4796-5p	CLIP-seq
MIRT946659	hsa-miR-4802-3p	CLIP-seq
MIRT946660	hsa-miR-507	CLIP-seq
MIRT946661	hsa-miR-520d-5p	CLIP-seq
MIRT946662	hsa-miR-520g	CLIP-seq
MIRT946663	hsa-miR-520h	CLIP-seq
MIRT946664	hsa-miR-524-5p	CLIP-seq
MIRT946665	hsa-miR-548ag	CLIP-seq
MIRT946666	hsa-miR-548ai	CLIP-seq
MIRT946667	hsa-miR-548k	CLIP-seq
MIRT946668	hsa-miR-548l	CLIP-seq
MIRT946669	hsa-miR-548n	CLIP-seq
MIRT946670	hsa-miR-548t	CLIP-seq
MIRT946671	hsa-miR-557	CLIP-seq
MIRT946672	hsa-miR-577	CLIP-seq
MIRT946673	hsa-miR-584	CLIP-seq
MIRT946674	hsa-miR-587	CLIP-seq
MIRT946675	hsa-miR-622	CLIP-seq
MIRT946676	hsa-miR-653	CLIP-seq
MIRT946677	hsa-miR-660	CLIP-seq
MIRT946678	hsa-miR-892b	CLIP-seq
MIRT946679	hsa-miR-935	CLIP-seq
MIRT946680	hsa-miR-940	CLIP-seq
MIRT946622	hsa-miR-411	CLIP-seq
MIRT946657	hsa-miR-4795-3p	CLIP-seq
MIRT946676	hsa-miR-653	CLIP-seq
MIRT1980379	hsa-miR-936	CLIP-seq
MIRT946680	hsa-miR-940	CLIP-seq
MIRT946591	hsa-miR-1284	CLIP-seq
MIRT2215399	hsa-miR-1912	CLIP-seq
MIRT946594	hsa-miR-193a-3p	CLIP-seq
MIRT946595	hsa-miR-193b	CLIP-seq
MIRT946603	hsa-miR-3124-3p	CLIP-seq
MIRT2215400	hsa-miR-3130-5p	CLIP-seq
MIRT2215401	hsa-miR-3144-3p	CLIP-seq
MIRT946607	hsa-miR-323-3p	CLIP-seq
MIRT946608	hsa-miR-331-5p	CLIP-seq
MIRT2215402	hsa-miR-3646	CLIP-seq
MIRT946614	hsa-miR-3691-3p	CLIP-seq
MIRT946616	hsa-miR-380	CLIP-seq
MIRT946622	hsa-miR-411	CLIP-seq
MIRT946629	hsa-miR-4477a	CLIP-seq
MIRT946630	hsa-miR-448	CLIP-seq
MIRT2215403	hsa-miR-4482	CLIP-seq
MIRT946631	hsa-miR-4495	CLIP-seq
MIRT946639	hsa-miR-4639-3p	CLIP-seq
MIRT946655	hsa-miR-4789-5p	CLIP-seq
MIRT946658	hsa-miR-4796-5p	CLIP-seq
MIRT946661	hsa-miR-520d-5p	CLIP-seq
MIRT946664	hsa-miR-524-5p	CLIP-seq
MIRT946668	hsa-miR-548l	CLIP-seq
MIRT946673	hsa-miR-584	CLIP-seq
MIRT946674	hsa-miR-587	CLIP-seq
MIRT946675	hsa-miR-622	CLIP-seq
MIRT946678	hsa-miR-892b	CLIP-seq
MIRT1980379	hsa-miR-936	CLIP-seq
MIRT2448564	hsa-miR-335	CLIP-seq
MIRT2448565	hsa-miR-4764-3p	CLIP-seq

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IDA	18794347
GO:0000209	Process	Protein polyubiquitination	TAS	17085480
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	18794347, 20129063
GO:0005515	Function	Protein binding	IPI	16949367, 17041588, 18794347, 23213251, 26431207, 27906959, 32814053, 33961781, 35271311, 36931259
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	17106265, 26431207
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	17106265
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006260	Process	DNA replication	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	18794347
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IMP	26431207
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS	17085480
GO:0006513	Process	Protein monoubiquitination	IDA	20129063
GO:0006974	Process	DNA damage response	IDA	20129063
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	16949367
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IBA
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IMP	17085480
GO:0009411	Process	Response to UV	IDA	18794347
GO:0009896	Process	Positive regulation of catabolic process	IEA
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IMP	16949367
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019985	Process	Translesion synthesis	IDA	20129063
GO:0030674	Function	Protein-macromolecule adaptor activity	IBA
GO:0031464	Component	Cul4A-RING E3 ubiquitin ligase complex	IDA	17085480, 18794347, 20129063, 21628527
GO:0031465	Component	Cul4B-RING E3 ubiquitin ligase complex	IDA	18794347
GO:0031965	Component	Nuclear membrane	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0045732	Process	Positive regulation of protein catabolic process	IMP	16949367
GO:0048511	Process	Rhythmic process	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	17085480
GO:0080008	Component	Cul4-RING E3 ubiquitin ligase complex	IMP	16949367

MIM	HGNC	e!Ensembl
610617	30288	ENSG00000143476

Q9NZJ0

Protein name

Denticleless protein homolog (DDB1- and CUL4-associated factor 2) (Lethal(2) denticleless protein homolog) (Retinoic acid-regulated nuclear matrix-associated protein)

Protein function

Substrate-specific adapter of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for cell cycle control, DNA damage response and translesion DNA synthesis. The DCX(DTL) complex, also named CRL4(CDT2) complex, mediates the polyu

PDB

6QC0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00400	WD40	88 → 126	WD domain, G-beta repeat	Repeat
PF00400	WD40	130 → 169	WD domain, G-beta repeat	Repeat
PF00400	WD40	210 → 244	WD domain, G-beta repeat	Repeat
PF00400	WD40	305 → 345	WD domain, G-beta repeat	Repeat
PF00400	WD40	350 → 389	WD domain, G-beta repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in placenta and testis, very low expression seen in skeletal muscle. Detected in all hematopoietic tissues examined, with highest expression in thymus and bone marrow. A low level detected in the spleen and lymph node, and ba

Sequence

MLFNSVLRQPQLGVLRNGWSSQYPLQSLLTGYQCSGNDEHTSYGETGVPVPPFGCTFSSA
PNMEHVLAVANEEGFVRLYNTESQSFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQ
TAKFWDVKAGELIGTCKGHQCSLKSVAFSKFEKAVFCTGGRDGNIMVWDTRCNKKDGFYR
QVNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLVSAGAVDGII
KVWDLRKNYTAYRQEPIASKSFLYPGSSTRKLGYSSLILDSTGSTLFANCTDDNIYMFNM
TGLKTSPVAIFNGHQNSTFYVKSSLSPDDQFLVSGSSDEAAYIWKVSTPWQPPTVLLGHS
QEVTSVCWCPSDFTKIATCSDDNTLKIWRLNRGLEEKPGGDKLSTVGWASQKKKESRPGL
VTVTSSQSTPAKAPRAKCNPSNSSPSSAACAPSCAGDLPLPSNTPTFSIKTSPAKARSPI
NRRGSVSSVSPKPPSSFKMSIRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQ
AEACSESRNRVKRRLDSSCLESVKQKCVKSCNCVTELDGQVENLHLDLCCLAGNQEDLSK
DSLGPTKSSKIEGAGTSISEPPSPISPYASESCGTLPLPLRPCGEGSEMVGKENSSPENK
NWLLAMAAKRKAENPSPRSPSSQTPNSRRQSGKKLPSPVTITPSSMRKICTYFHRKSQED
FCGPEHSTEL

Sequence length

730

Interactions

View interactions

	Reactome
			Recognition of DNA damage by PCNA-containing replication complex Neddylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, ADENOID CYSTIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SALIVARY GLAND NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (62)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28336923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	16762588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	30402980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35200126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	25010197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	35003319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30018073, 30245026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28410206, 29235520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27379929, 29235520, 31182966, 34675265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19672268, 30402980, 35103094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	31914060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	11278750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17106265, 29962817, 31822116, 34746301, 35392073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37038185	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	15548371, 32899691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	31705877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30415951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	30402980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	9499416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21752725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22287560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21752725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	27333051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29246949, 30155847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29246949, 30155847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34365093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	21822310, 25008066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	34404366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	15619030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	19672268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37038185	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17106265, 29606879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29235520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35850313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29235520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29606879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29235520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	CTD_human_DG	16762588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19672268, 26472028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21212733, 23995842, 25115388, 26472028, 30415951, 31409387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21752725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18542055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29235520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	30402980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	30402980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27333051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36320118	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	BEFREE	9499416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	25008066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	9499416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17106265, 21752725, 21822310, 23026210, 23892434, 26472028, 29606879, 30415951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31729978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	CTD_human_DG	16762588		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Ewing	Sarcoma	Pubtator	25008066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23026210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25186767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28838998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19672268, 26472028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19672268, 26472028, 37038185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35103094, 37038185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23052694, 40680432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DTL (denticleless E3 ubiquitin protein ligase adapter)