ETV7 (ETS variant transcription factor 7)

Gene

• Entrez ID: 51513
• Gene name: ETS variant transcription factor 7
• Gene symbol: ETV7
• Synonyms (NCBI Gene): TEL-2, TEL2, TELB
• Chromosome: 6
• Chromosome location: 6p21.31
• Summary: The protein encoded by this gene belongs to the ETS family of transcription factors, which is a large group of evolutionarily conserved transcriptional regulators that play an important role in a variety of cellular processes throughout development and di

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023696	hsa-miR-1-3p	Microarray	18668037
MIRT488939	hsa-miR-483-5p	PAR-CLIP	23592263
MIRT488938	hsa-miR-922	PAR-CLIP	23592263
MIRT488937	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT488936	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT488935	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT488934	hsa-miR-4530	PAR-CLIP	23592263
MIRT488933	hsa-miR-542-5p	PAR-CLIP	23592263
MIRT488932	hsa-miR-4450	PAR-CLIP	23592263
MIRT488931	hsa-miR-6511b-5p	PAR-CLIP	23592263
MIRT488929	hsa-miR-6811-5p	PAR-CLIP	23592263
MIRT488939	hsa-miR-483-5p	PAR-CLIP	23592263
MIRT488938	hsa-miR-922	PAR-CLIP	23592263
MIRT488937	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT488936	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT488935	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT488934	hsa-miR-4530	PAR-CLIP	23592263
MIRT488933	hsa-miR-542-5p	PAR-CLIP	23592263
MIRT488932	hsa-miR-4450	PAR-CLIP	23592263
MIRT488931	hsa-miR-6511b-5p	PAR-CLIP	23592263
MIRT488929	hsa-miR-6811-5p	PAR-CLIP	23592263
MIRT972127	hsa-miR-1193	CLIP-seq
MIRT972128	hsa-miR-3614-3p	CLIP-seq
MIRT972129	hsa-miR-3689a-3p	CLIP-seq
MIRT972130	hsa-miR-3689c	CLIP-seq
MIRT972131	hsa-miR-4297	CLIP-seq
MIRT972132	hsa-miR-4728-5p	CLIP-seq
MIRT972133	hsa-miR-4328	CLIP-seq
MIRT972134	hsa-miR-582-5p	CLIP-seq
MIRT972135	hsa-miR-3192	CLIP-seq
MIRT972136	hsa-miR-3194-3p	CLIP-seq
MIRT972137	hsa-miR-346	CLIP-seq
MIRT972129	hsa-miR-3689a-3p	CLIP-seq
MIRT972130	hsa-miR-3689c	CLIP-seq
MIRT972138	hsa-miR-4294	CLIP-seq
MIRT972131	hsa-miR-4297	CLIP-seq
MIRT972132	hsa-miR-4728-5p	CLIP-seq
MIRT972139	hsa-miR-4731-5p	CLIP-seq
MIRT972140	hsa-miR-765	CLIP-seq
MIRT2222453	hsa-miR-150	CLIP-seq
MIRT2222454	hsa-miR-1915	CLIP-seq
MIRT2222455	hsa-miR-3175	CLIP-seq
MIRT2222456	hsa-miR-342-5p	CLIP-seq
MIRT2222457	hsa-miR-4664-5p	CLIP-seq
MIRT2222458	hsa-miR-4713-5p	CLIP-seq
MIRT2222459	hsa-miR-4726-3p	CLIP-seq
MIRT2222460	hsa-miR-532-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11108721
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	11108721
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	11108721
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	12588862
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	10828014
GO:0005654	Component	Nucleoplasm	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	10828014
GO:0009887	Process	Animal organ morphogenesis	TAS	10828014
GO:0030154	Process	Cell differentiation	IBA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 605255
• HGNC: 18160
• e!Ensembl: ENSG00000010030

Protein

• UniProt ID: Q9Y603
• Protein name: Transcription factor ETV7 (ETS translocation variant 7) (ETS-related protein Tel2) (Tel-related Ets factor) (Transcription factor Tel-2)
• Protein function: Transcriptional repressor; binds to the DNA sequence 5'-CCGGAAGT-3'. Isoform A does not seem to have a repressor activity. Isoform C does not seem to have a repressor activity.
• PDB: 9HK0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02198	SAM_PNT	39 → 117	Sterile alpha motif (SAM)/Pointed domain	Domain
  PF00178	Ets	225 → 305	Ets-domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in hematopoietic tissues.
• Sequence:

  MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVL
  HWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRAL
  VCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLA
  RWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYE
  PYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQKL
  LFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP

• Sequence length: 341

Pathways

KEGG:

Transcriptional misregulation in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	30025229		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17172821, 37041130	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30025229, 34315857	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17172821	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32908909	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38200280	Stimulate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	30478527		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30025229	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	39746786	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15342392, 16234363		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15743832		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30025229		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15743832, 28693791, 30258985		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33424867	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	23263282		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	16234363		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31323273		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26335051, 30253797		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30258985		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32544083	Associate	★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	15743832		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	30258985		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34926692	Associate	★☆☆☆☆ Found in Text Mining only