Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51512
Gene name	G2 and S-phase expressed 1
Gene symbol	GTSE1
Synonyms (NCBI Gene)	B99
Chromosome	22
Chromosome location	22q13.31
Summary	The protein encoded by this gene is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor supp

Show/Hide all (96)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042290	hsa-miR-484	CLASH	23622248
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT1038269	hsa-miR-122	CLIP-seq
MIRT1038270	hsa-miR-1224-3p	CLIP-seq
MIRT1038271	hsa-miR-1245b-5p	CLIP-seq
MIRT1038272	hsa-miR-1262	CLIP-seq
MIRT1038273	hsa-miR-1293	CLIP-seq
MIRT1038274	hsa-miR-1297	CLIP-seq
MIRT1038275	hsa-miR-150	CLIP-seq
MIRT1038276	hsa-miR-151-5p	CLIP-seq
MIRT1038277	hsa-miR-151b	CLIP-seq
MIRT1038278	hsa-miR-1973	CLIP-seq
MIRT1038279	hsa-miR-2114	CLIP-seq
MIRT1038280	hsa-miR-23a	CLIP-seq
MIRT1038281	hsa-miR-23b	CLIP-seq
MIRT1038282	hsa-miR-23c	CLIP-seq
MIRT1038283	hsa-miR-2467-3p	CLIP-seq
MIRT1038284	hsa-miR-2467-5p	CLIP-seq
MIRT1038285	hsa-miR-26a	CLIP-seq
MIRT1038286	hsa-miR-26b	CLIP-seq
MIRT1038287	hsa-miR-296-3p	CLIP-seq
MIRT1038288	hsa-miR-3123	CLIP-seq
MIRT1038289	hsa-miR-3135b	CLIP-seq
MIRT1038290	hsa-miR-3142	CLIP-seq
MIRT1038291	hsa-miR-3156-3p	CLIP-seq
MIRT1038292	hsa-miR-3157-5p	CLIP-seq
MIRT1038293	hsa-miR-3168	CLIP-seq
MIRT1038294	hsa-miR-3188	CLIP-seq
MIRT1038295	hsa-miR-3189-3p	CLIP-seq
MIRT1038296	hsa-miR-3199	CLIP-seq
MIRT1038297	hsa-miR-323-5p	CLIP-seq
MIRT1038298	hsa-miR-338-3p	CLIP-seq
MIRT1038299	hsa-miR-342-3p	CLIP-seq
MIRT1038300	hsa-miR-3652	CLIP-seq
MIRT1038301	hsa-miR-3919	CLIP-seq
MIRT1038302	hsa-miR-3925-3p	CLIP-seq
MIRT1038303	hsa-miR-3960	CLIP-seq
MIRT1038304	hsa-miR-3975	CLIP-seq
MIRT1038305	hsa-miR-4301	CLIP-seq
MIRT1038306	hsa-miR-4430	CLIP-seq
MIRT1038307	hsa-miR-4438	CLIP-seq
MIRT1038308	hsa-miR-4465	CLIP-seq
MIRT1038309	hsa-miR-4467	CLIP-seq
MIRT1038310	hsa-miR-4483	CLIP-seq
MIRT1038311	hsa-miR-4530	CLIP-seq
MIRT1038312	hsa-miR-4646-5p	CLIP-seq
MIRT1038313	hsa-miR-4649-3p	CLIP-seq
MIRT1038314	hsa-miR-4690-3p	CLIP-seq
MIRT1038315	hsa-miR-4701-3p	CLIP-seq
MIRT1038316	hsa-miR-4779	CLIP-seq
MIRT1038317	hsa-miR-485-5p	CLIP-seq
MIRT1038318	hsa-miR-491-3p	CLIP-seq
MIRT1038319	hsa-miR-5095	CLIP-seq
MIRT1038320	hsa-miR-562	CLIP-seq
MIRT1038321	hsa-miR-766	CLIP-seq
MIRT1038322	hsa-miR-885-3p	CLIP-seq
MIRT1038269	hsa-miR-122	CLIP-seq
MIRT1038289	hsa-miR-3135b	CLIP-seq
MIRT1038300	hsa-miR-3652	CLIP-seq
MIRT1038306	hsa-miR-4430	CLIP-seq
MIRT2007836	hsa-miR-4705	CLIP-seq
MIRT2240494	hsa-miR-140-3p	CLIP-seq
MIRT1038275	hsa-miR-150	CLIP-seq
MIRT1038280	hsa-miR-23a	CLIP-seq
MIRT1038281	hsa-miR-23b	CLIP-seq
MIRT1038282	hsa-miR-23c	CLIP-seq
MIRT2240495	hsa-miR-3149	CLIP-seq
MIRT1038291	hsa-miR-3156-3p	CLIP-seq
MIRT1038292	hsa-miR-3157-5p	CLIP-seq
MIRT1038296	hsa-miR-3199	CLIP-seq
MIRT1038305	hsa-miR-4301	CLIP-seq
MIRT1038307	hsa-miR-4438	CLIP-seq
MIRT1038314	hsa-miR-4690-3p	CLIP-seq
MIRT1038319	hsa-miR-5095	CLIP-seq
MIRT2240496	hsa-miR-532-3p	CLIP-seq
MIRT1038320	hsa-miR-562	CLIP-seq
MIRT2240494	hsa-miR-140-3p	CLIP-seq
MIRT1038296	hsa-miR-3199	CLIP-seq
MIRT1038307	hsa-miR-4438	CLIP-seq
MIRT1038319	hsa-miR-5095	CLIP-seq
MIRT2450892	hsa-miR-941	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20577264, 37219487
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005881	Component	Cytoplasmic microtubule	IBA
GO:0005881	Component	Cytoplasmic microtubule	IDA	10974554
GO:0007017	Process	Microtubule-based process	NAS	10974554
GO:0008017	Function	Microtubule binding	IBA
GO:0015630	Component	Microtubule cytoskeleton	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	NAS	10974554

MIM	HGNC	e!Ensembl
607477	13698	ENSG00000075218

Q9NYZ3

Protein name

G2 and S phase-expressed protein 1 (GTSE-1) (Protein B99 homolog)

Protein function

May be involved in p53-induced cell cycle arrest in G2/M phase by interfering with microtubule rearrangements that are required to enter mitosis. Overexpression delays G2/M phase progression.

PDB

6QNN , 6QNP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15259	GTSE1_N	9 → 152	G-2 and S-phase expressed 1	Family

Sequence

MDDPKKEDILLLADEKFDFDLSLSSSSANEDDEVFFGPFGHKERCIAASLELNNPVPEQP
PLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQAAQAAKPEDPRSQGVERFIQ
ESKLKINLFEKEKEMKKSPTSLKRETYYLSDSPLLGPPVGEPRLLASSPALPSSGAQARL
TRAPGPPHSAHALPRESCTAHAASQAATQRKPGTKLLLPRAASVRGRSIPGAAEKPKKEI
PASPSRTKIPAEKESHRDVLPDKPAPGAVNVPAAGSHLGQGKRAIPVPNKLGLKKTLLKA
PGSTSNLARKSSSGPVWSGASSACTSPAVGKAKSSEFASIPANSSRPLSNISKSGRMGPA
MLRPALPAGPVGASSWQAKRVDVSELAAEQLTAPPSASPTQPQTPEGGGQWLNSSCAWSE
SSQLNKTRSIRRRDSCLNSKTKVMPTPTNQFKIPKFSIGDSPDSSTPKLSRAQRPQSCTS
VGRVTVHSTPVRRSSGPAPQSLLSAWRVSALPTPASRRCSGLPPMTPKTMPRAVGSPLCV
PARRRSSEPRKNSAMRTEPTRESNRKTDSRLVDVSPDRGSPPSRVPQALNFSPEESDSTF
SKSTATEVAREEAKPGGDAAPSEALLVDIKLEPLAVTPDAASQPLIDLPLIDFCDTPEAH
VAVGSESRPLIDLMTNTPDMNKNVAKPSPVVGQLIDLSSPLIQLSPEADKENVDSPLLKF

Sequence length

720

Interactions

View interactions

	KEGG		Reactome
	p53 signaling pathway		G2/M Checkpoints The role of GTSE1 in G2/M progression after G2 checkpoint

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (35)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	22292647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	34818353	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30414902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23236459, 27485113, 28978043, 30961661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23236459, 27485113, 32705365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28698581, 32082966, 33880590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	26349752	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30414902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22292647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28260099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35585131	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	26349752	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22292647, 26349752	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	27881713	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	36543921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	25748237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27240802, 28698581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22292647	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34007784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37079439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23236459, 28978043, 30961661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22292647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26209226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30414902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27240802, 28978043		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29660787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23236459, 27240802, 28029658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28029658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30406363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22292647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26209226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26209226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28978043, 30961661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25921176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GTSE1 (G2 and S-phase expressed 1)