Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51495
Gene name	3-hydroxyacyl-CoA dehydratase 3
Gene symbol	HACD3
Synonyms (NCBI Gene)	B-IND1BIND1HSPC121PTPLAD1
Chromosome	15
Chromosome location	15q22.31

Show/Hide all (26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT534931	hsa-miR-330-3p	PAR-CLIP	22012620
MIRT534930	hsa-miR-3920	PAR-CLIP	22012620
MIRT534929	hsa-miR-29a-5p	PAR-CLIP	22012620
MIRT534928	hsa-miR-433-3p	PAR-CLIP	22012620
MIRT534927	hsa-miR-3192-3p	PAR-CLIP	22012620
MIRT534926	hsa-miR-607	PAR-CLIP	22012620
MIRT534925	hsa-miR-4762-3p	PAR-CLIP	22012620
MIRT443724	hsa-miR-4724-5p	PAR-CLIP	22100165
MIRT193891	hsa-miR-4524b-3p	PAR-CLIP	22100165
MIRT072640	hsa-miR-1324	PAR-CLIP	22100165
MIRT193889	hsa-miR-3166	PAR-CLIP	22100165
MIRT443723	hsa-miR-4771	PAR-CLIP	22100165
MIRT193892	hsa-miR-1273h-3p	PAR-CLIP	22100165
MIRT754444	hsa-miR-330-3p	PAR-CLIP	22012620
MIRT754445	hsa-miR-3920	PAR-CLIP	22012620
MIRT754446	hsa-miR-29a-5p	PAR-CLIP	22012620
MIRT754447	hsa-miR-433-3p	PAR-CLIP	22012620
MIRT754448	hsa-miR-3192-3p	PAR-CLIP	22012620
MIRT754449	hsa-miR-607	PAR-CLIP	22012620
MIRT754450	hsa-miR-4762-3p	PAR-CLIP	22012620
MIRT755286	hsa-miR-4724-5p	PAR-CLIP	22100165
MIRT193891	hsa-miR-4524b-3p	PAR-CLIP	22100165
MIRT072640	hsa-miR-1324	PAR-CLIP	22100165
MIRT193889	hsa-miR-3166	PAR-CLIP	22100165
MIRT755287	hsa-miR-4771	PAR-CLIP	22100165
MIRT193892	hsa-miR-1273h-3p	PAR-CLIP	22100165

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	TAS	10747961
GO:0005515	Function	Protein binding	IPI	18160438, 23935497, 26618866, 29924966, 31324722, 35271311, 36012204
GO:0005783	Component	Endoplasmic reticulum	IDA	18554506
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	TAS	10747961
GO:0007254	Process	JNK cascade	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	TAS	10747961
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0016601	Process	Rac protein signal transduction	NAS	10747961
GO:0016829	Function	Lyase activity	IEA
GO:0018812	Function	3-hydroxyacyl-CoA dehydratase activity	IBA
GO:0019899	Function	Enzyme binding	IDA	18554506
GO:0030148	Process	Sphingolipid biosynthetic process	IBA
GO:0030497	Process	Fatty acid elongation	IBA
GO:0030497	Process	Fatty acid elongation	IDA	18554506
GO:0031965	Component	Nuclear membrane	IDA
GO:0042761	Process	Very long-chain fatty acid biosynthetic process	IBA
GO:0042761	Process	Very long-chain fatty acid biosynthetic process	IDA	18554506
GO:0045070	Process	Positive regulation of viral genome replication	IMP	18160438
GO:0046726	Process	Positive regulation by virus of viral protein levels in host cell	IMP	18160438
GO:0102158	Function	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase activity	IDA	18554506
GO:0102158	Function	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase activity	IEA
GO:1902532	Process	Negative regulation of intracellular signal transduction	IEA

MIM	HGNC	e!Ensembl
615940	24175	ENSG00000074696

Q9P035

Protein name

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 (EC 4.2.1.134) (3-hydroxyacyl-CoA dehydratase 3) (HACD3) (Butyrate-induced protein 1) (B-ind1) (hB-ind1) (Protein-tyrosine phosphatase-like A domain-containing protein 1)

Protein function

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cyc

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04387	PTPLA	195 → 356	Protein tyrosine phosphatase-like protein, PTPLA	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in testis, kidney, brain, liver and weakly in skeletal muscle, spleen and heart. No expression detected in leukocytes. {ECO:0000269|PubMed:10747961, ECO:0000269|PubMed:18554506}.

Sequence

MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLE
FLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL
RAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESF
YDTFHTVADMMYFCQMLAVVETINAAIGVTTSPVLPSLIQLLGRNFILFIIFGTMEEMQN
KAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQS
IPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKK
IH

Sequence length

362

Interactions

View interactions

	KEGG		Reactome
	Fatty acid elongation Biosynthesis of unsaturated fatty acids Metabolic pathways Fatty acid metabolism		Synthesis of very long-chain fatty acyl-CoAs

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33378017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31610545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30300385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31610545, 31819986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31610545		★★★★★ ★☆☆☆☆ Found in Text Mining only

HACD3 (3-hydroxyacyl-CoA dehydratase 3)