Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51451
Gene name	Leucine carboxyl methyltransferase 1
Gene symbol	LCMT1
Synonyms (NCBI Gene)	CGI-68LCMTPPMT1
Chromosome	16
Chromosome location	16p12.1
Summary	LCMT1 catalyzes the methylation of the carboxyl group of the C-terminal leucine residue (leu309) of the catalytic subunit of protein phosphatase-2A (PPP2CA; MIM 176915) (De Baere et al., 1999 [PubMed 10600115]).[supplied by OMIM, Mar 2008]

Show/Hide all (90)

miRTarBase ID	miRNA	Experiments
MIRT1105704	hsa-miR-1255a	CLIP-seq
MIRT1105705	hsa-miR-1255b	CLIP-seq
MIRT1105706	hsa-miR-1266	CLIP-seq
MIRT1105707	hsa-miR-1280	CLIP-seq
MIRT1105708	hsa-miR-149	CLIP-seq
MIRT1105709	hsa-miR-3064-5p	CLIP-seq
MIRT1105710	hsa-miR-335	CLIP-seq
MIRT1105711	hsa-miR-3614-3p	CLIP-seq
MIRT1105712	hsa-miR-3616-3p	CLIP-seq
MIRT1105713	hsa-miR-3665	CLIP-seq
MIRT1105714	hsa-miR-4270	CLIP-seq
MIRT1105715	hsa-miR-4279	CLIP-seq
MIRT1105716	hsa-miR-4300	CLIP-seq
MIRT1105717	hsa-miR-4304	CLIP-seq
MIRT1105718	hsa-miR-4327	CLIP-seq
MIRT1105719	hsa-miR-4441	CLIP-seq
MIRT1105720	hsa-miR-4459	CLIP-seq
MIRT1105721	hsa-miR-4518	CLIP-seq
MIRT1105722	hsa-miR-4648	CLIP-seq
MIRT1105723	hsa-miR-4654	CLIP-seq
MIRT1105724	hsa-miR-4691-5p	CLIP-seq
MIRT1105725	hsa-miR-4707-3p	CLIP-seq
MIRT1105726	hsa-miR-4747-3p	CLIP-seq
MIRT1105727	hsa-miR-4754	CLIP-seq
MIRT1105728	hsa-miR-4769-5p	CLIP-seq
MIRT1105729	hsa-miR-4779	CLIP-seq
MIRT1105730	hsa-miR-4786-5p	CLIP-seq
MIRT1105731	hsa-miR-4794	CLIP-seq
MIRT1105732	hsa-miR-513c	CLIP-seq
MIRT1105733	hsa-miR-514b-5p	CLIP-seq
MIRT1105734	hsa-miR-574-5p	CLIP-seq
MIRT1105735	hsa-miR-657	CLIP-seq
MIRT1105736	hsa-miR-665	CLIP-seq
MIRT1105737	hsa-miR-769-5p	CLIP-seq
MIRT1105738	hsa-miR-920	CLIP-seq
MIRT1105739	hsa-miR-1183	CLIP-seq
MIRT1105740	hsa-miR-142-3p	CLIP-seq
MIRT1105741	hsa-miR-3125	CLIP-seq
MIRT1105742	hsa-miR-3916	CLIP-seq
MIRT1105743	hsa-miR-3928	CLIP-seq
MIRT1105744	hsa-miR-421	CLIP-seq
MIRT1105745	hsa-miR-4709-5p	CLIP-seq
MIRT1105746	hsa-miR-505	CLIP-seq
MIRT1105747	hsa-miR-873	CLIP-seq
MIRT1105706	hsa-miR-1266	CLIP-seq
MIRT1105707	hsa-miR-1280	CLIP-seq
MIRT1105708	hsa-miR-149	CLIP-seq
MIRT1105709	hsa-miR-3064-5p	CLIP-seq
MIRT1105712	hsa-miR-3616-3p	CLIP-seq
MIRT1105713	hsa-miR-3665	CLIP-seq
MIRT1105714	hsa-miR-4270	CLIP-seq
MIRT1105715	hsa-miR-4279	CLIP-seq
MIRT1105716	hsa-miR-4300	CLIP-seq
MIRT1105717	hsa-miR-4304	CLIP-seq
MIRT1105718	hsa-miR-4327	CLIP-seq
MIRT1105719	hsa-miR-4441	CLIP-seq
MIRT1105720	hsa-miR-4459	CLIP-seq
MIRT1105721	hsa-miR-4518	CLIP-seq
MIRT1105724	hsa-miR-4691-5p	CLIP-seq
MIRT1105725	hsa-miR-4707-3p	CLIP-seq
MIRT1105726	hsa-miR-4747-3p	CLIP-seq
MIRT1105727	hsa-miR-4754	CLIP-seq
MIRT1105729	hsa-miR-4779	CLIP-seq
MIRT1105730	hsa-miR-4786-5p	CLIP-seq
MIRT1105731	hsa-miR-4794	CLIP-seq
MIRT1105735	hsa-miR-657	CLIP-seq
MIRT1105736	hsa-miR-665	CLIP-seq
MIRT1105737	hsa-miR-769-5p	CLIP-seq
MIRT1105738	hsa-miR-920	CLIP-seq
MIRT1105706	hsa-miR-1266	CLIP-seq
MIRT1105707	hsa-miR-1280	CLIP-seq
MIRT1105712	hsa-miR-3616-3p	CLIP-seq
MIRT1105713	hsa-miR-3665	CLIP-seq
MIRT1105714	hsa-miR-4270	CLIP-seq
MIRT1105715	hsa-miR-4279	CLIP-seq
MIRT1105716	hsa-miR-4300	CLIP-seq
MIRT1105718	hsa-miR-4327	CLIP-seq
MIRT1105719	hsa-miR-4441	CLIP-seq
MIRT1105720	hsa-miR-4459	CLIP-seq
MIRT1105721	hsa-miR-4518	CLIP-seq
MIRT1105724	hsa-miR-4691-5p	CLIP-seq
MIRT1105725	hsa-miR-4707-3p	CLIP-seq
MIRT1105726	hsa-miR-4747-3p	CLIP-seq
MIRT1105727	hsa-miR-4754	CLIP-seq
MIRT1105729	hsa-miR-4779	CLIP-seq
MIRT1105730	hsa-miR-4786-5p	CLIP-seq
MIRT1105735	hsa-miR-657	CLIP-seq
MIRT1105736	hsa-miR-665	CLIP-seq
MIRT1105737	hsa-miR-769-5p	CLIP-seq
MIRT1105738	hsa-miR-920	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0003880	Function	Protein C-terminal carboxyl O-methyltransferase activity	IDA	10600115
GO:0003880	Function	Protein C-terminal carboxyl O-methyltransferase activity	TAS	10600115
GO:0005515	Function	Protein binding	IPI	16189514
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0006479	Process	Protein methylation	IMP	17724024
GO:0006481	Process	C-terminal protein methylation	IDA	10600115
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008276	Function	Protein methyltransferase activity	IEA
GO:0008757	Function	S-adenosylmethionine-dependent methyltransferase activity	IEA
GO:0008757	Function	S-adenosylmethionine-dependent methyltransferase activity	TAS	10600115
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0010906	Process	Regulation of glucose metabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018423	Function	Protein C-terminal leucine carboxyl O-methyltransferase activity	IBA
GO:0018423	Function	Protein C-terminal leucine carboxyl O-methyltransferase activity	IEA
GO:0018423	Function	Protein C-terminal leucine carboxyl O-methyltransferase activity	TAS
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IMP	17724024
GO:0032259	Process	Methylation	IEA
GO:0036211	Process	Protein modification process	TAS	10600115
GO:0042981	Process	Regulation of apoptotic process	IMP	17724024
GO:0090266	Process	Regulation of mitotic cell cycle spindle assembly checkpoint	IBA
GO:0090266	Process	Regulation of mitotic cell cycle spindle assembly checkpoint	IMP	17724024

MIM	HGNC	e!Ensembl
610286	17557	ENSG00000205629

Q9UIC8

Protein name

Leucine carboxyl methyltransferase 1 (EC 2.1.1.233) (Protein-leucine O-methyltransferase) ([Phosphatase 2A protein]-leucine-carboxy methyltransferase 1)

Protein function

Methylates the carboxyl group of the C-terminal leucine residue of protein phosphatase 2A catalytic subunits to form alpha-leucine ester residues.

PDB

3IEI , 3O7W , 3P71

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04072	LCM	25 → 217	Leucine carboxyl methyltransferase	Family

Sequence

MATRQRESSITSCCSTSSCDADDEGVRGTCEDASLCKRFAVSIGYWHDPYIQHFVRLSKE
RKAPEINRGYFARVHGVSQLIKAFLRKTECHCQIVNLGAGMDTTFWRLKDEDLLPSKYFE
VDFPMIVTRKLHSIKCKPPLSSPILELHSEDTLQMDGHILDSKRYAVIGADLRDLSELEE
KLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNMGDRFGQI
MIENLRRRQCDLAGVETCKSLESQKERLLSNGWETASAVDMMELYNRLPRAEVSRIESLE
FLDEMELLEQLMRHYCLCWATKGGNELGLKEITY

Sequence length

334

Interactions

View interactions

	Reactome
			Cyclin A/B1/B2 associated events during G2/M transition

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36341373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27810903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27810903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23943618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23943618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	29281045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37644036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	29281045		★★★★★ ★☆☆☆☆ Found in Text Mining only

LCMT1 (leucine carboxyl methyltransferase 1)