Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51441
Gene name	YTH N6-methyladenosine RNA binding protein F2
Gene symbol	YTHDF2
Synonyms (NCBI Gene)	CAHLDF2HGRG8NY-REN-2
Chromosome	1
Chromosome location	1p35.3
Summary	This gene encodes a member of the YTH (YT521-B homology) superfamily containing YTH domain. The YTH domain is typical for the eukaryotes and is particularly abundant in plants. The YTH domain is usually located in the middle of the protein sequence and ma

131

Show/Hide all (131)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023842	hsa-miR-1-3p	Proteomics	18668040
MIRT044257	hsa-miR-106b-5p	CLASH	23622248
MIRT040054	hsa-miR-615-3p	CLASH	23622248
MIRT734028	hsa-miR-495-3p	Immunoprecipitaion (IP)Luciferase reporter assayqRT-PCRWestern blotting	33087165
MIRT734028	hsa-miR-495-3p	Immunohistochemistry (IHC)Immunoprecipitaion (IP)Luciferase reporter assayWestern blotting	33087165
MIRT1499900	hsa-miR-1238	CLIP-seq
MIRT1499901	hsa-miR-130a	CLIP-seq
MIRT1499902	hsa-miR-130b	CLIP-seq
MIRT1499903	hsa-miR-19a	CLIP-seq
MIRT1499904	hsa-miR-19b	CLIP-seq
MIRT1499905	hsa-miR-2113	CLIP-seq
MIRT1499906	hsa-miR-2117	CLIP-seq
MIRT1499907	hsa-miR-2276	CLIP-seq
MIRT1499908	hsa-miR-301a	CLIP-seq
MIRT1499909	hsa-miR-301b	CLIP-seq
MIRT1499910	hsa-miR-3201	CLIP-seq
MIRT1499911	hsa-miR-323b-3p	CLIP-seq
MIRT1499912	hsa-miR-3611	CLIP-seq
MIRT1499913	hsa-miR-3666	CLIP-seq
MIRT1499914	hsa-miR-3689a-3p	CLIP-seq
MIRT1499915	hsa-miR-3689c	CLIP-seq
MIRT1499916	hsa-miR-3691-3p	CLIP-seq
MIRT1499917	hsa-miR-4255	CLIP-seq
MIRT1499918	hsa-miR-4273	CLIP-seq
MIRT1499919	hsa-miR-4295	CLIP-seq
MIRT1499920	hsa-miR-454	CLIP-seq
MIRT1499921	hsa-miR-4698	CLIP-seq
MIRT1499922	hsa-miR-4728-5p	CLIP-seq
MIRT1499923	hsa-miR-4791	CLIP-seq
MIRT1499924	hsa-miR-511	CLIP-seq
MIRT1499925	hsa-miR-515-5p	CLIP-seq
MIRT1499926	hsa-miR-519a	CLIP-seq
MIRT1499927	hsa-miR-519b-3p	CLIP-seq
MIRT1499928	hsa-miR-519c-3p	CLIP-seq
MIRT1499929	hsa-miR-548g	CLIP-seq
MIRT1499930	hsa-miR-651	CLIP-seq
MIRT1499931	hsa-miR-654-3p	CLIP-seq
MIRT1499932	hsa-miR-758	CLIP-seq
MIRT1499933	hsa-miR-765	CLIP-seq
MIRT1499934	hsa-miR-1179	CLIP-seq
MIRT1499935	hsa-miR-3194-3p	CLIP-seq
MIRT1499936	hsa-miR-3613-3p	CLIP-seq
MIRT1499937	hsa-miR-4475	CLIP-seq
MIRT1499938	hsa-miR-4766-5p	CLIP-seq
MIRT1499939	hsa-miR-101	CLIP-seq
MIRT1499940	hsa-miR-1236	CLIP-seq
MIRT1499900	hsa-miR-1238	CLIP-seq
MIRT1499941	hsa-miR-1260	CLIP-seq
MIRT1499942	hsa-miR-1260b	CLIP-seq
MIRT1499943	hsa-miR-1278	CLIP-seq
MIRT1499944	hsa-miR-144	CLIP-seq
MIRT1499945	hsa-miR-181a	CLIP-seq
MIRT1499946	hsa-miR-181b	CLIP-seq
MIRT1499947	hsa-miR-181c	CLIP-seq
MIRT1499948	hsa-miR-181d	CLIP-seq
MIRT1499949	hsa-miR-188-3p	CLIP-seq
MIRT1499950	hsa-miR-30a	CLIP-seq
MIRT1499951	hsa-miR-30b	CLIP-seq
MIRT1499952	hsa-miR-30c	CLIP-seq
MIRT1499953	hsa-miR-30d	CLIP-seq
MIRT1499954	hsa-miR-30e	CLIP-seq
MIRT1499955	hsa-miR-3117-3p	CLIP-seq
MIRT1499956	hsa-miR-3124-3p	CLIP-seq
MIRT1499957	hsa-miR-3156-3p	CLIP-seq
MIRT1499958	hsa-miR-3165	CLIP-seq
MIRT1499959	hsa-miR-3169	CLIP-seq
MIRT1499960	hsa-miR-3185	CLIP-seq
MIRT1499910	hsa-miR-3201	CLIP-seq
MIRT1499961	hsa-miR-342-5p	CLIP-seq
MIRT1499962	hsa-miR-3607-3p	CLIP-seq
MIRT1499963	hsa-miR-365	CLIP-seq
MIRT1499964	hsa-miR-3686	CLIP-seq
MIRT1499965	hsa-miR-3691-5p	CLIP-seq
MIRT1499966	hsa-miR-4262	CLIP-seq
MIRT1499967	hsa-miR-4301	CLIP-seq
MIRT1499968	hsa-miR-4314	CLIP-seq
MIRT1499969	hsa-miR-4651	CLIP-seq
MIRT1499970	hsa-miR-4652-3p	CLIP-seq
MIRT1499971	hsa-miR-4664-5p	CLIP-seq
MIRT1499972	hsa-miR-4667-5p	CLIP-seq
MIRT1499921	hsa-miR-4698	CLIP-seq
MIRT1499973	hsa-miR-4700-5p	CLIP-seq
MIRT1499974	hsa-miR-4753-3p	CLIP-seq
MIRT1499975	hsa-miR-4759	CLIP-seq
MIRT1499976	hsa-miR-4768-5p	CLIP-seq
MIRT1499977	hsa-miR-4773	CLIP-seq
MIRT1499923	hsa-miR-4791	CLIP-seq
MIRT1499978	hsa-miR-494	CLIP-seq
MIRT1499979	hsa-miR-495	CLIP-seq
MIRT1499980	hsa-miR-543	CLIP-seq
MIRT1499981	hsa-miR-582-5p	CLIP-seq
MIRT1499982	hsa-miR-586	CLIP-seq
MIRT1499983	hsa-miR-608	CLIP-seq
MIRT1499984	hsa-miR-637	CLIP-seq
MIRT1499985	hsa-miR-647	CLIP-seq
MIRT1499930	hsa-miR-651	CLIP-seq
MIRT1499986	hsa-miR-802	CLIP-seq
MIRT1499987	hsa-miR-938	CLIP-seq
MIRT1499900	hsa-miR-1238	CLIP-seq
MIRT2150504	hsa-miR-145	CLIP-seq
MIRT2150505	hsa-miR-3180-5p	CLIP-seq
MIRT2150506	hsa-miR-579	CLIP-seq
MIRT1499901	hsa-miR-130a	CLIP-seq
MIRT1499902	hsa-miR-130b	CLIP-seq
MIRT1499903	hsa-miR-19a	CLIP-seq
MIRT1499904	hsa-miR-19b	CLIP-seq
MIRT1499906	hsa-miR-2117	CLIP-seq
MIRT1499908	hsa-miR-301a	CLIP-seq
MIRT1499909	hsa-miR-301b	CLIP-seq
MIRT1499913	hsa-miR-3666	CLIP-seq
MIRT1499916	hsa-miR-3691-3p	CLIP-seq
MIRT1499917	hsa-miR-4255	CLIP-seq
MIRT1499918	hsa-miR-4273	CLIP-seq
MIRT1499919	hsa-miR-4295	CLIP-seq
MIRT1499920	hsa-miR-454	CLIP-seq
MIRT1499921	hsa-miR-4698	CLIP-seq
MIRT1499925	hsa-miR-515-5p	CLIP-seq
MIRT1499926	hsa-miR-519a	CLIP-seq
MIRT1499927	hsa-miR-519b-3p	CLIP-seq
MIRT1499928	hsa-miR-519c-3p	CLIP-seq
MIRT1499944	hsa-miR-144	CLIP-seq
MIRT1499921	hsa-miR-4698	CLIP-seq
MIRT2463736	hsa-miR-129-5p	CLIP-seq
MIRT2463736	hsa-miR-129-5p	CLIP-seq
MIRT2664521	hsa-miR-629	CLIP-seq
MIRT1499907	hsa-miR-2276	CLIP-seq
MIRT2695440	hsa-miR-3921	CLIP-seq
MIRT2695441	hsa-miR-4653-5p	CLIP-seq
MIRT2695442	hsa-miR-4772-3p	CLIP-seq
MIRT1499929	hsa-miR-548g	CLIP-seq
MIRT2695443	hsa-miR-593	CLIP-seq

Show/Hide all (65)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IDA	24284625, 31292544, 32492408
GO:0000932	Component	P-body	IEA
GO:0001556	Process	Oocyte maturation	IEA
GO:0001556	Process	Oocyte maturation	ISS
GO:0002376	Process	Immune system process	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0005515	Function	Protein binding	IPI	24965446, 28106072, 30930054
GO:0005634	Component	Nucleus	IDA	26458103
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	32492408
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	26458103
GO:0005829	Component	Cytosol	IEA
GO:0006402	Process	MRNA catabolic process	IDA	27558897, 30559377, 30930054
GO:0006402	Process	MRNA catabolic process	IEA
GO:0006959	Process	Humoral immune response	TAS	10508479
GO:0007276	Process	Gamete generation	IEA
GO:0007276	Process	Gamete generation	ISS
GO:0007283	Process	Spermatogenesis	IEA
GO:0007284	Process	Spermatogonial cell division	IEA
GO:0007284	Process	Spermatogonial cell division	ISS
GO:0010494	Component	Cytoplasmic stress granule	IDA	31292544, 32451507
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030155	Process	Regulation of cell adhesion	ISS
GO:0034063	Process	Stress granule assembly	IDA	32451507
GO:0034063	Process	Stress granule assembly	IEA
GO:0034451	Component	Centriolar satellite	IDA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0043488	Process	Regulation of mRNA stability	IDA	32492408
GO:0043488	Process	Regulation of mRNA stability	IEA
GO:0043488	Process	Regulation of mRNA stability	IMP	24284625, 26046440
GO:0045087	Process	Innate immune response	IEA
GO:0045746	Process	Negative regulation of Notch signaling pathway	ISS
GO:0045948	Process	Positive regulation of translational initiation	IDA	32492408
GO:0048477	Process	Oogenesis	IEA
GO:0048598	Process	Embryonic morphogenesis	ISS
GO:0050767	Process	Regulation of neurogenesis	IEA
GO:0050767	Process	Regulation of neurogenesis	IMP	32169943
GO:0050767	Process	Regulation of neurogenesis	ISS
GO:0051301	Process	Cell division	IEA
GO:0060339	Process	Negative regulation of type I interferon-mediated signaling pathway	IMP	30559377
GO:0061157	Process	MRNA destabilization	IBA
GO:0061157	Process	MRNA destabilization	IDA	27558897, 30559377, 30930054, 32492408
GO:0061157	Process	MRNA destabilization	IEA
GO:0061157	Process	MRNA destabilization	IMP	28106072, 32169943
GO:0062153	Function	C5-methylcytidine-containing RNA reader activity	IDA	31815440
GO:0070925	Process	Organelle assembly	IDA	31292544
GO:0071425	Process	Hematopoietic stem cell proliferation	IEA
GO:0071425	Process	Hematopoietic stem cell proliferation	ISS
GO:0098508	Process	Endothelial to hematopoietic transition	ISS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	IEA
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	ISS
GO:1903538	Process	Regulation of meiotic cell cycle process involved in oocyte maturation	IEA
GO:1903538	Process	Regulation of meiotic cell cycle process involved in oocyte maturation	ISS
GO:1903679	Process	Positive regulation of cap-independent translational initiation	IDA	26458103
GO:1990247	Function	N6-methyladenosine-containing RNA reader activity	IBA
GO:1990247	Function	N6-methyladenosine-containing RNA reader activity	IDA	22575960, 24284625, 25412658, 25412661, 26046440, 26318451, 26458103, 27558897, 28106072, 30559377, 30930054, 31292544, 32169943, 32451507, 32492408
GO:1990247	Function	N6-methyladenosine-containing RNA reader activity	IEA
GO:2000232	Process	Regulation of rRNA processing	IMP	31815440
GO:2000737	Process	Negative regulation of stem cell differentiation	IMP	32169943

MIM	HGNC	e!Ensembl
610640	31675	ENSG00000198492

Q9Y5A9

Protein name

YTH domain-containing family protein 2 (DF2) (CLL-associated antigen KW-14) (High-glucose-regulated protein 8) (Renal carcinoma antigen NY-REN-2)

Protein function

Specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, and regulates their stability (PubMed:24284625, PubMed:26046440, PubMed:26318451, PubMed:32492408). M6A is a modification present at internal sites of mRNAs and some non

PDB

4RDN , 4RDO , 4WQN , 7A1V , 7BIK , 7R5F , 7R5L , 7R5W , 7YWB , 7YX6 , 7YXE , 7Z26 , 7Z4U , 7Z54 , 7Z5M , 7Z7B , 7Z7F , 7Z8P , 7Z8W , 7Z8X , 7Z92 , 7Z93 , 7ZG4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04146	YTH	410 → 545	YT521-B-like domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in induced pluripotent stem cells (iPSCs) and down-regulated during neural differentiation. {ECO:0000269|PubMed:32169943}.

Sequence

MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYY
SPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQH
GFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAP
GMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWA
DIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPT
QGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSG
FGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSE
DDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYN
TCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQV
LKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK

Sequence length

579

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (65)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	32884942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35776431	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36216883, 36609396, 37499929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32126149, 32948220, 33411363, 33726814, 35512522, 35730068, 37515378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36609396	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	33692441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	35512522	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28104805, 32111180, 32631107, 32733931, 34234878, 34609072, 34647424, 34747720, 35833147, 36339682, 37833468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34221187, 37515378	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31504235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	32948220	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35840930, 38164857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	37315764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	37907028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35094011, 35696608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33411363, 33415160, 37194014, 37203239, 37264959, 37381158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	36595818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36333113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36891946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	35512522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34347888, 34889221, 35512522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36675186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34054840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	35139773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	30107516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33023892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34432221, 35661004, 36123877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	30065315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34609072, 35499052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	37730054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	37315764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	37386016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31031138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28104805, 29423080, 30423408, 31735169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28104805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34408926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	32583611, 32685056	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	35120571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29171881, 31735169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31504235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29135329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29423080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28104805, 31031138, 31735169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33726814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37012388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	38190128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29423080, 30423408, 31504235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37006311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36034449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35490460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32948220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29135329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29135329, 35422475, 35609514, 37149664, 37923686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37309980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36133437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29423080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36133437, 37831104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	35487915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	29659627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34207099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35499052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32126149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	35512522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36028854, 37273106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	37315764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

YTHDF2 (YTH N6-methyladenosine RNA binding protein F2)