Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51435
Gene name	Scavenger receptor class A member 3
Gene symbol	SCARA3
Synonyms (NCBI Gene)	APC7CSRCSR1MSLR1MSRL1
Chromosome	8
Chromosome location	8p21.1
Summary	This gene encodes a macrophage scavenger receptor-like protein. This protein has been shown to deplete reactive oxygen species, and thus play an important role in protecting cells from oxidative stress. The expression of this gene is induced by oxidative

130

Show/Hide all (130)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030128	hsa-miR-26b-5p	Microarray	19088304
MIRT040380	hsa-miR-615-3p	CLASH	23622248
MIRT1328388	hsa-miR-10a	CLIP-seq
MIRT1328389	hsa-miR-10b	CLIP-seq
MIRT1328390	hsa-miR-130a	CLIP-seq
MIRT1328391	hsa-miR-130b	CLIP-seq
MIRT1328392	hsa-miR-148a	CLIP-seq
MIRT1328393	hsa-miR-148b	CLIP-seq
MIRT1328394	hsa-miR-152	CLIP-seq
MIRT1328395	hsa-miR-19a	CLIP-seq
MIRT1328396	hsa-miR-19b	CLIP-seq
MIRT1328397	hsa-miR-200b	CLIP-seq
MIRT1328398	hsa-miR-200c	CLIP-seq
MIRT1328399	hsa-miR-219-2-3p	CLIP-seq
MIRT1328400	hsa-miR-2467-3p	CLIP-seq
MIRT1328401	hsa-miR-2964a-3p	CLIP-seq
MIRT1328402	hsa-miR-298	CLIP-seq
MIRT1328403	hsa-miR-301a	CLIP-seq
MIRT1328404	hsa-miR-301b	CLIP-seq
MIRT1328405	hsa-miR-3140-5p	CLIP-seq
MIRT1328406	hsa-miR-3151	CLIP-seq
MIRT1328407	hsa-miR-3179	CLIP-seq
MIRT1328408	hsa-miR-342-5p	CLIP-seq
MIRT1328409	hsa-miR-3620	CLIP-seq
MIRT1328410	hsa-miR-3666	CLIP-seq
MIRT1328411	hsa-miR-3667-3p	CLIP-seq
MIRT1328412	hsa-miR-3944-5p	CLIP-seq
MIRT1328413	hsa-miR-4268	CLIP-seq
MIRT1328414	hsa-miR-429	CLIP-seq
MIRT1328415	hsa-miR-4295	CLIP-seq
MIRT1328416	hsa-miR-4320	CLIP-seq
MIRT1328417	hsa-miR-4433	CLIP-seq
MIRT1328418	hsa-miR-4436a	CLIP-seq
MIRT1328419	hsa-miR-4436b-3p	CLIP-seq
MIRT1328420	hsa-miR-4447	CLIP-seq
MIRT1328421	hsa-miR-4448	CLIP-seq
MIRT1328422	hsa-miR-4455	CLIP-seq
MIRT1328423	hsa-miR-4459	CLIP-seq
MIRT1328424	hsa-miR-4466	CLIP-seq
MIRT1328425	hsa-miR-4472	CLIP-seq
MIRT1328426	hsa-miR-454	CLIP-seq
MIRT1328427	hsa-miR-4645-5p	CLIP-seq
MIRT1328428	hsa-miR-4651	CLIP-seq
MIRT1328429	hsa-miR-4664-5p	CLIP-seq
MIRT1328430	hsa-miR-4673	CLIP-seq
MIRT1328431	hsa-miR-4768-3p	CLIP-seq
MIRT1328432	hsa-miR-4779	CLIP-seq
MIRT1328433	hsa-miR-4790-3p	CLIP-seq
MIRT1328434	hsa-miR-487a	CLIP-seq
MIRT1328435	hsa-miR-491-5p	CLIP-seq
MIRT1328436	hsa-miR-608	CLIP-seq
MIRT1328437	hsa-miR-665	CLIP-seq
MIRT1328438	hsa-miR-675	CLIP-seq
MIRT2097462	hsa-miR-1286	CLIP-seq
MIRT2097463	hsa-miR-199a-5p	CLIP-seq
MIRT2097464	hsa-miR-199b-5p	CLIP-seq
MIRT2097465	hsa-miR-3183	CLIP-seq
MIRT2097466	hsa-miR-3675-5p	CLIP-seq
MIRT1328412	hsa-miR-3944-5p	CLIP-seq
MIRT2097467	hsa-miR-4279	CLIP-seq
MIRT2097468	hsa-miR-4302	CLIP-seq
MIRT2097469	hsa-miR-4480	CLIP-seq
MIRT2097470	hsa-miR-4704-3p	CLIP-seq
MIRT2097471	hsa-miR-4722-5p	CLIP-seq
MIRT2097472	hsa-miR-4723-3p	CLIP-seq
MIRT2097473	hsa-miR-4727-5p	CLIP-seq
MIRT2097474	hsa-miR-4749-3p	CLIP-seq
MIRT1328431	hsa-miR-4768-3p	CLIP-seq
MIRT2097475	hsa-miR-4769-3p	CLIP-seq
MIRT2097476	hsa-miR-541	CLIP-seq
MIRT2097477	hsa-miR-654-5p	CLIP-seq
MIRT2321763	hsa-miR-140-3p	CLIP-seq
MIRT1328397	hsa-miR-200b	CLIP-seq
MIRT1328398	hsa-miR-200c	CLIP-seq
MIRT2321764	hsa-miR-210	CLIP-seq
MIRT1328402	hsa-miR-298	CLIP-seq
MIRT2321765	hsa-miR-299-3p	CLIP-seq
MIRT2321766	hsa-miR-3138	CLIP-seq
MIRT2321767	hsa-miR-3673	CLIP-seq
MIRT2321768	hsa-miR-371b-3p	CLIP-seq
MIRT2321769	hsa-miR-4257	CLIP-seq
MIRT1328414	hsa-miR-429	CLIP-seq
MIRT2321770	hsa-miR-4313	CLIP-seq
MIRT2321771	hsa-miR-4491	CLIP-seq
MIRT2321772	hsa-miR-4520a-3p	CLIP-seq
MIRT2321773	hsa-miR-4657	CLIP-seq
MIRT2321774	hsa-miR-4751	CLIP-seq
MIRT1328431	hsa-miR-4768-3p	CLIP-seq
MIRT1328433	hsa-miR-4790-3p	CLIP-seq
MIRT2321775	hsa-miR-4800-5p	CLIP-seq
MIRT1328434	hsa-miR-487a	CLIP-seq
MIRT1328405	hsa-miR-3140-5p	CLIP-seq
MIRT1328407	hsa-miR-3179	CLIP-seq
MIRT1328411	hsa-miR-3667-3p	CLIP-seq
MIRT1328413	hsa-miR-4268	CLIP-seq
MIRT1328421	hsa-miR-4448	CLIP-seq
MIRT1328427	hsa-miR-4645-5p	CLIP-seq
MIRT1328430	hsa-miR-4673	CLIP-seq
MIRT2458883	hsa-miR-297	CLIP-seq
MIRT2458884	hsa-miR-455-5p	CLIP-seq
MIRT2458885	hsa-miR-548c-3p	CLIP-seq
MIRT2458886	hsa-miR-567	CLIP-seq
MIRT2618189	hsa-miR-1182	CLIP-seq
MIRT2618190	hsa-miR-1202	CLIP-seq
MIRT2618191	hsa-miR-1273g	CLIP-seq
MIRT2618192	hsa-miR-138	CLIP-seq
MIRT2618193	hsa-miR-193a-5p	CLIP-seq
MIRT2618194	hsa-miR-3115	CLIP-seq
MIRT2618195	hsa-miR-3150a-3p	CLIP-seq
MIRT2618196	hsa-miR-3175	CLIP-seq
MIRT2618197	hsa-miR-331-3p	CLIP-seq
MIRT2097466	hsa-miR-3675-5p	CLIP-seq
MIRT2618198	hsa-miR-3972	CLIP-seq
MIRT2618199	hsa-miR-4281	CLIP-seq
MIRT2618200	hsa-miR-4532	CLIP-seq
MIRT2618201	hsa-miR-4728-3p	CLIP-seq
MIRT2618202	hsa-miR-4728-5p	CLIP-seq
MIRT2618203	hsa-miR-4755-3p	CLIP-seq
MIRT2618204	hsa-miR-581	CLIP-seq
MIRT2618205	hsa-miR-939	CLIP-seq
MIRT2618192	hsa-miR-138	CLIP-seq
MIRT2618194	hsa-miR-3115	CLIP-seq
MIRT2618195	hsa-miR-3150a-3p	CLIP-seq
MIRT2618196	hsa-miR-3175	CLIP-seq
MIRT2618197	hsa-miR-331-3p	CLIP-seq
MIRT2097466	hsa-miR-3675-5p	CLIP-seq
MIRT2618199	hsa-miR-4281	CLIP-seq
MIRT2618200	hsa-miR-4532	CLIP-seq
MIRT2618201	hsa-miR-4728-3p	CLIP-seq
MIRT2618205	hsa-miR-939	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0005044	Function	Scavenger receptor activity	TAS	9580669
GO:0005515	Function	Protein binding	IPI	25416956, 32814053, 33961781
GO:0005581	Component	Collagen trimer	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0006979	Process	Response to oxidative stress	TAS	9580669
GO:0009650	Process	UV protection	TAS	9580669
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA

MIM	HGNC	e!Ensembl
602728	19000	ENSG00000168077

Q6AZY7

Protein name

Scavenger receptor class A member 3 (Cellular stress response gene protein)

Protein function

Seems to protect cells by scavenging oxidative molecules or harmful products of oxidation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01391	Collagen	455 → 513	Collagen triple helix repeat (20 copies)	Repeat
PF01391	Collagen	493 → 558	Collagen triple helix repeat (20 copies)	Repeat
PF01391	Collagen	544 → 604	Collagen triple helix repeat (20 copies)	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed ubiquitously. {ECO:0000269|PubMed:9580669}.

Sequence

MKVRSAGGDGDALCVTEEDLAGDDEDMPTFPCTQKGRPGPRCSRCQKNLSLHTSVRILYL
FLALLLVAVAVLASLVFRKVDSLSEDISLTQSIYDKKLVLMQKNLQGLDPKALNNCSFCH
EAGQLGPEIRKLQEELEGIQKLLLAQEVQLDQTLQAQEVLSTTSRQISQEMGSCSFSIHQ
VNQSLGLFLAQVRGWQATTAGLDLSLKDLTQECYDVKAAVHQINFTVGQTSEWIHGIQRK
TDEETLTLQKIVTDWQNYTRLFSGLRTTSTKTGEAVKNIQATLGASSQRISQNSESMHDL
VLQVMGLQLQLDNISSFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTI
FTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRERFSLL
SARLDLNVRNLSMIVEEMKAVDTQHGEILRNVTILRGAPGPPGPRGFKGDMGVKGPVGGR
GPKGDPGSLGPLGPQGPQGQPGEAGPVGERGPVGPRGFPGLKGSKGSFGTGGPRGQPGPK
GDIGPPGPEGPPGSPGPSGPQGKPGIAGKTGSPGQRGAMGPKGEPGIQGPPGLPGPPGPP
GSQSFY

Sequence length

606

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCARA3-related disorder	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (27)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	15743504, 21855113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21855113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28975986	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20152043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27441470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29102807, 30946471, 31237174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	26362256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	15743504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29102807, 30946471, 31237174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28975986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	29789916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15743504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20152043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16436673, 25956032, 28975986, 29705808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	17560278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	21855113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	23537707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23537707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	29857857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16436673, 16815105, 20152043, 21855113, 25956032, 27148859, 28975986, 29705808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary peritoneal carcinoma	Peritoneal Carcinoma	BEFREE	21855113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16436673, 25956032, 28975986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16436673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18806823, 22683311, 29705808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28975986	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34586953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	31331197		★★★★★ ★☆☆☆☆ Found in Text Mining only

SCARA3 (scavenger receptor class A member 3)