Gene Gene information from NCBI Gene database.
Entrez ID 5143
Gene name Phosphodiesterase 4C
Gene symbol PDE4C
Synonyms (NCBI Gene)
DPDE1PDE21
Chromosome 19
Chromosome location 19p13.11
Summary The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE4 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular sign
miRNA miRNA information provided by mirtarbase database.
586
miRTarBase ID miRNA Experiments Reference
MIRT722937 hsa-miR-125a-3p HITS-CLIP 19536157
MIRT722936 hsa-miR-764 HITS-CLIP 19536157
MIRT722935 hsa-miR-3934-5p HITS-CLIP 19536157
MIRT722934 hsa-miR-3664-3p HITS-CLIP 19536157
MIRT722933 hsa-miR-1266-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0004114 Function 3',5'-cyclic-nucleotide phosphodiesterase activity IEA
GO:0004115 Function 3',5'-cyclic-AMP phosphodiesterase activity IBA
GO:0004115 Function 3',5'-cyclic-AMP phosphodiesterase activity IDA 7843419
GO:0004115 Function 3',5'-cyclic-AMP phosphodiesterase activity IEA
GO:0004115 Function 3',5'-cyclic-AMP phosphodiesterase activity TAS 9349724
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600128 8782 ENSG00000105650
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q08493
Protein name 3',5'-cyclic-AMP phosphodiesterase 4C (EC 3.1.4.53) (DPDE1) (PDE21) (cAMP-specific phosphodiesterase 4C)
Protein function Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.
PDB 2QYM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18100 PDE4_UCR 152 268 Phosphodiesterase 4 upstream conserved regions (UCR) Domain
PF00233 PDEase_I 387 628 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in various tissues but not in cells of the immune system. {ECO:0000269|PubMed:7843419}.
Sequence
MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERD
LSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQSSPGLGRIMQAPVPHSQRRESF
LYRSDSDYELSPKAMSRNSSVASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQCLGA
AKQGPVGNPSSSNQLPPAEDTGQKLALETLDELDWCLDQLETLQTRHSVGEMASNKFKRI
LNRELTHLSETSRSGNQVSEYISRTFLD
QQTEVELPKVTAEEAPQPMSRISGLHGLCHSA
SLSSATVPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAIIFSIFQERDLL
KTFQIPADTLATYLLMLEGHYHANVAYHNSLHAADVAQSTHVLLATPALEAVFTDLEILA
ALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQAENCDIFQNL
SAKQRLSLRRMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQN
LVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGF
IDYIAHPLWETWADLVHPDAQDLLDTLE
DNREWYQSKIPRSPSDLTNPERDGPDRFQFEL
TLEEAEEEDEEEEEEGEETALAKEALELPDTELLSPEAGPDPGDLPLDNQRT
Sequence length 712
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Purine metabolism
Metabolic pathways
cAMP signaling pathway
Parathyroid hormone synthesis, secretion and action
Morphine addiction
  DARPP-32 events
G alpha (s) signalling events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
GOUT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenoma Adenoma BEFREE 11502813
★☆☆☆☆
Found in Text Mining only
Congenital Hyperinsulinism Congenital hyperinsulinism Pubtator 23869231 Associate
★☆☆☆☆
Found in Text Mining only
Down Syndrome Down Syndrome BEFREE 27234618
★☆☆☆☆
Found in Text Mining only
Down Syndrome Down syndrome Pubtator 27293319 Associate
★☆☆☆☆
Found in Text Mining only
Glioma Glioma BEFREE 24842301
★☆☆☆☆
Found in Text Mining only
Malignant Glioma Glioma BEFREE 24842301
★☆☆☆☆
Found in Text Mining only
melanoma Melanoma BEFREE 9349724
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 24842301
★☆☆☆☆
Found in Text Mining only
Pancreatic Neoplasms Pancreatic neoplasm Pubtator 36275722 Associate
★☆☆☆☆
Found in Text Mining only
Thyroid Cancer Papillary Papillary thyroid cancer Pubtator 40427523 Associate
★☆☆☆☆
Found in Text Mining only