Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5142
Gene name	Phosphodiesterase 4B
Gene symbol	PDE4B
Synonyms (NCBI Gene)	DPDE4PDEIVB
Chromosome	1
Chromosome location	1p31.3
Summary	This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. The encoded protein regulates the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction. Altered act

507

Show/Hide all (507)

miRTarBase ID	miRNA	Experiments	Reference
MIRT144178	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT726989	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT726988	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT144178	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT1220468	hsa-miR-1207-5p	CLIP-seq
MIRT1220469	hsa-miR-130a	CLIP-seq
MIRT1220470	hsa-miR-130b	CLIP-seq
MIRT1220471	hsa-miR-148a	CLIP-seq
MIRT1220472	hsa-miR-148b	CLIP-seq
MIRT1220473	hsa-miR-152	CLIP-seq
MIRT1220474	hsa-miR-2682	CLIP-seq
MIRT1220475	hsa-miR-298	CLIP-seq
MIRT1220476	hsa-miR-301a	CLIP-seq
MIRT1220477	hsa-miR-301b	CLIP-seq
MIRT1220478	hsa-miR-34a	CLIP-seq
MIRT1220479	hsa-miR-34c-5p	CLIP-seq
MIRT1220480	hsa-miR-3591-3p	CLIP-seq
MIRT1220481	hsa-miR-3666	CLIP-seq
MIRT1220482	hsa-miR-3714	CLIP-seq
MIRT1220483	hsa-miR-4295	CLIP-seq
MIRT1220484	hsa-miR-449a	CLIP-seq
MIRT1220485	hsa-miR-449b	CLIP-seq
MIRT1220486	hsa-miR-449c	CLIP-seq
MIRT1220487	hsa-miR-454	CLIP-seq
MIRT1220488	hsa-miR-4696	CLIP-seq
MIRT1220489	hsa-miR-4736	CLIP-seq
MIRT1220490	hsa-miR-4742-5p	CLIP-seq
MIRT1220491	hsa-miR-4763-3p	CLIP-seq
MIRT1220492	hsa-miR-221	CLIP-seq
MIRT1220493	hsa-miR-222	CLIP-seq
MIRT1220494	hsa-miR-23a	CLIP-seq
MIRT1220495	hsa-miR-23b	CLIP-seq
MIRT1220496	hsa-miR-23c	CLIP-seq
MIRT1220497	hsa-miR-3145-5p	CLIP-seq
MIRT1220498	hsa-miR-3160-5p	CLIP-seq
MIRT1220499	hsa-miR-3163	CLIP-seq
MIRT1220500	hsa-miR-340	CLIP-seq
MIRT1220501	hsa-miR-345	CLIP-seq
MIRT1220502	hsa-miR-3545-3p	CLIP-seq
MIRT1220503	hsa-miR-4256	CLIP-seq
MIRT1220504	hsa-miR-4277	CLIP-seq
MIRT1220505	hsa-miR-431	CLIP-seq
MIRT1220506	hsa-miR-4422	CLIP-seq
MIRT1220507	hsa-miR-4539	CLIP-seq
MIRT1220508	hsa-miR-4728-3p	CLIP-seq
MIRT1220509	hsa-miR-4762-3p	CLIP-seq
MIRT1220510	hsa-miR-4766-5p	CLIP-seq
MIRT1220511	hsa-miR-4795-3p	CLIP-seq
MIRT1220512	hsa-miR-494	CLIP-seq
MIRT1220513	hsa-miR-499-3p	CLIP-seq
MIRT1220514	hsa-miR-499a-3p	CLIP-seq
MIRT1220515	hsa-miR-548c-3p	CLIP-seq
MIRT1220516	hsa-miR-21	CLIP-seq
MIRT1220517	hsa-miR-3613-3p	CLIP-seq
MIRT1220518	hsa-miR-488	CLIP-seq
MIRT1220519	hsa-miR-505	CLIP-seq
MIRT1220520	hsa-miR-561	CLIP-seq
MIRT1220521	hsa-miR-590-5p	CLIP-seq
MIRT1220492	hsa-miR-221	CLIP-seq
MIRT1220493	hsa-miR-222	CLIP-seq
MIRT1220494	hsa-miR-23a	CLIP-seq
MIRT1220495	hsa-miR-23b	CLIP-seq
MIRT1220496	hsa-miR-23c	CLIP-seq
MIRT1220522	hsa-miR-3188	CLIP-seq
MIRT1220523	hsa-miR-361-5p	CLIP-seq
MIRT1220524	hsa-miR-548v	CLIP-seq
MIRT1220468	hsa-miR-1207-5p	CLIP-seq
MIRT2063628	hsa-miR-1278	CLIP-seq
MIRT2063629	hsa-miR-1827	CLIP-seq
MIRT2063630	hsa-miR-204	CLIP-seq
MIRT2063631	hsa-miR-211	CLIP-seq
MIRT2063632	hsa-miR-2113	CLIP-seq
MIRT2063633	hsa-miR-3124-3p	CLIP-seq
MIRT2063634	hsa-miR-3166	CLIP-seq
MIRT1220480	hsa-miR-3591-3p	CLIP-seq
MIRT2063635	hsa-miR-3612	CLIP-seq
MIRT2063636	hsa-miR-4264	CLIP-seq
MIRT2063637	hsa-miR-4328	CLIP-seq
MIRT2063638	hsa-miR-4443	CLIP-seq
MIRT2063639	hsa-miR-4446-5p	CLIP-seq
MIRT2063640	hsa-miR-4470	CLIP-seq
MIRT2063641	hsa-miR-452	CLIP-seq
MIRT2063642	hsa-miR-4652-3p	CLIP-seq
MIRT2063643	hsa-miR-4676-3p	CLIP-seq
MIRT2063644	hsa-miR-4711-3p	CLIP-seq
MIRT2063645	hsa-miR-4719	CLIP-seq
MIRT1220489	hsa-miR-4736	CLIP-seq
MIRT1220490	hsa-miR-4742-5p	CLIP-seq
MIRT2063646	hsa-miR-4755-5p	CLIP-seq
MIRT1220491	hsa-miR-4763-3p	CLIP-seq
MIRT2063647	hsa-miR-4797-3p	CLIP-seq
MIRT2063648	hsa-miR-548k	CLIP-seq
MIRT1220520	hsa-miR-561	CLIP-seq
MIRT2063649	hsa-miR-592	CLIP-seq
MIRT2063650	hsa-miR-599	CLIP-seq
MIRT2063651	hsa-miR-623	CLIP-seq
MIRT2063652	hsa-miR-650	CLIP-seq
MIRT2063653	hsa-miR-940	CLIP-seq
MIRT2063628	hsa-miR-1278	CLIP-seq
MIRT2063629	hsa-miR-1827	CLIP-seq
MIRT2063635	hsa-miR-3612	CLIP-seq
MIRT2063638	hsa-miR-4443	CLIP-seq
MIRT2063640	hsa-miR-4470	CLIP-seq
MIRT2063641	hsa-miR-452	CLIP-seq
MIRT2063643	hsa-miR-4676-3p	CLIP-seq
MIRT1220490	hsa-miR-4742-5p	CLIP-seq
MIRT2063648	hsa-miR-548k	CLIP-seq
MIRT2063652	hsa-miR-650	CLIP-seq
MIRT2063653	hsa-miR-940	CLIP-seq
MIRT1220490	hsa-miR-4742-5p	CLIP-seq
MIRT2063628	hsa-miR-1278	CLIP-seq
MIRT2063629	hsa-miR-1827	CLIP-seq
MIRT2063635	hsa-miR-3612	CLIP-seq
MIRT2063638	hsa-miR-4443	CLIP-seq
MIRT2063640	hsa-miR-4470	CLIP-seq
MIRT2063641	hsa-miR-452	CLIP-seq
MIRT2063643	hsa-miR-4676-3p	CLIP-seq
MIRT1220490	hsa-miR-4742-5p	CLIP-seq
MIRT2063648	hsa-miR-548k	CLIP-seq
MIRT2063652	hsa-miR-650	CLIP-seq
MIRT2063653	hsa-miR-940	CLIP-seq
MIRT1220492	hsa-miR-221	CLIP-seq
MIRT1220493	hsa-miR-222	CLIP-seq
MIRT1220494	hsa-miR-23a	CLIP-seq
MIRT1220495	hsa-miR-23b	CLIP-seq
MIRT1220496	hsa-miR-23c	CLIP-seq
MIRT1220499	hsa-miR-3163	CLIP-seq
MIRT1220522	hsa-miR-3188	CLIP-seq
MIRT2431953	hsa-miR-323-3p	CLIP-seq
MIRT1220500	hsa-miR-340	CLIP-seq
MIRT1220504	hsa-miR-4277	CLIP-seq
MIRT1220511	hsa-miR-4795-3p	CLIP-seq
MIRT1220513	hsa-miR-499-3p	CLIP-seq
MIRT1220514	hsa-miR-499a-3p	CLIP-seq
MIRT1220524	hsa-miR-548v	CLIP-seq
MIRT1220518	hsa-miR-488	CLIP-seq
MIRT2589695	hsa-miR-1179	CLIP-seq
MIRT2589696	hsa-miR-1206	CLIP-seq
MIRT1220468	hsa-miR-1207-5p	CLIP-seq
MIRT2589697	hsa-miR-1227	CLIP-seq
MIRT2589698	hsa-miR-1244	CLIP-seq
MIRT2589699	hsa-miR-1269	CLIP-seq
MIRT2589700	hsa-miR-1269b	CLIP-seq
MIRT2589701	hsa-miR-1273d	CLIP-seq
MIRT2063628	hsa-miR-1278	CLIP-seq
MIRT2589702	hsa-miR-1288	CLIP-seq
MIRT2589703	hsa-miR-1291	CLIP-seq
MIRT2589704	hsa-miR-134	CLIP-seq
MIRT2589705	hsa-miR-140-3p	CLIP-seq
MIRT2589706	hsa-miR-142-3p	CLIP-seq
MIRT2589707	hsa-miR-145	CLIP-seq
MIRT2589708	hsa-miR-1587	CLIP-seq
MIRT2063629	hsa-miR-1827	CLIP-seq
MIRT2589709	hsa-miR-1914	CLIP-seq
MIRT2589710	hsa-miR-199a-3p	CLIP-seq
MIRT2589711	hsa-miR-199b-3p	CLIP-seq
MIRT2589712	hsa-miR-2054	CLIP-seq
MIRT2063632	hsa-miR-2113	CLIP-seq
MIRT1220492	hsa-miR-221	CLIP-seq
MIRT1220493	hsa-miR-222	CLIP-seq
MIRT2589713	hsa-miR-2355-3p	CLIP-seq
MIRT1220494	hsa-miR-23a	CLIP-seq
MIRT1220495	hsa-miR-23b	CLIP-seq
MIRT1220496	hsa-miR-23c	CLIP-seq
MIRT2589714	hsa-miR-3074-5p	CLIP-seq
MIRT2589715	hsa-miR-3118	CLIP-seq
MIRT2589716	hsa-miR-3120-3p	CLIP-seq
MIRT2589717	hsa-miR-3129-5p	CLIP-seq
MIRT2589718	hsa-miR-3162-3p	CLIP-seq
MIRT1220499	hsa-miR-3163	CLIP-seq
MIRT1220522	hsa-miR-3188	CLIP-seq
MIRT2431953	hsa-miR-323-3p	CLIP-seq
MIRT2589719	hsa-miR-328	CLIP-seq
MIRT1220500	hsa-miR-340	CLIP-seq
MIRT1220502	hsa-miR-3545-3p	CLIP-seq
MIRT2589720	hsa-miR-3607-3p	CLIP-seq
MIRT2063635	hsa-miR-3612	CLIP-seq
MIRT1220523	hsa-miR-361-5p	CLIP-seq
MIRT2589721	hsa-miR-3622b-5p	CLIP-seq
MIRT2589722	hsa-miR-3654	CLIP-seq
MIRT2589723	hsa-miR-3658	CLIP-seq
MIRT2589724	hsa-miR-3665	CLIP-seq
MIRT2589725	hsa-miR-3686	CLIP-seq
MIRT2589726	hsa-miR-370	CLIP-seq
MIRT2589727	hsa-miR-375	CLIP-seq
MIRT2589728	hsa-miR-376a	CLIP-seq
MIRT2589729	hsa-miR-376b	CLIP-seq
MIRT2589730	hsa-miR-3913-3p	CLIP-seq
MIRT2589731	hsa-miR-3944-5p	CLIP-seq
MIRT2589732	hsa-miR-3973	CLIP-seq
MIRT2589733	hsa-miR-3975	CLIP-seq
MIRT2589734	hsa-miR-421	CLIP-seq
MIRT2589735	hsa-miR-4255	CLIP-seq
MIRT2589736	hsa-miR-4268	CLIP-seq
MIRT2589737	hsa-miR-4270	CLIP-seq
MIRT2589738	hsa-miR-4272	CLIP-seq
MIRT1220504	hsa-miR-4277	CLIP-seq
MIRT2589739	hsa-miR-4318	CLIP-seq
MIRT2589740	hsa-miR-4417	CLIP-seq
MIRT1220506	hsa-miR-4422	CLIP-seq
MIRT2589741	hsa-miR-4441	CLIP-seq
MIRT2063638	hsa-miR-4443	CLIP-seq
MIRT2589742	hsa-miR-4448	CLIP-seq
MIRT2589743	hsa-miR-4459	CLIP-seq
MIRT2063640	hsa-miR-4470	CLIP-seq
MIRT2589744	hsa-miR-4492	CLIP-seq
MIRT2589745	hsa-miR-4498	CLIP-seq
MIRT2589746	hsa-miR-4514	CLIP-seq
MIRT2589747	hsa-miR-4515	CLIP-seq
MIRT2063641	hsa-miR-452	CLIP-seq
MIRT2589748	hsa-miR-4528	CLIP-seq
MIRT2589749	hsa-miR-4529-3p	CLIP-seq
MIRT1220507	hsa-miR-4539	CLIP-seq
MIRT2589750	hsa-miR-4638-3p	CLIP-seq
MIRT2589751	hsa-miR-4640-3p	CLIP-seq
MIRT2063642	hsa-miR-4652-3p	CLIP-seq
MIRT2589752	hsa-miR-4653-3p	CLIP-seq
MIRT2589753	hsa-miR-4656	CLIP-seq
MIRT2589754	hsa-miR-4661-3p	CLIP-seq
MIRT2589755	hsa-miR-4675	CLIP-seq
MIRT2063643	hsa-miR-4676-3p	CLIP-seq
MIRT2589756	hsa-miR-4677-3p	CLIP-seq
MIRT2589757	hsa-miR-4678	CLIP-seq
MIRT2589758	hsa-miR-4679	CLIP-seq
MIRT2589759	hsa-miR-4692	CLIP-seq
MIRT2589760	hsa-miR-4695-5p	CLIP-seq
MIRT2589761	hsa-miR-4709-5p	CLIP-seq
MIRT2589762	hsa-miR-4720-3p	CLIP-seq
MIRT2589763	hsa-miR-4720-5p	CLIP-seq
MIRT2589764	hsa-miR-4722-5p	CLIP-seq
MIRT1220508	hsa-miR-4728-3p	CLIP-seq
MIRT2589765	hsa-miR-4735-5p	CLIP-seq
MIRT1220489	hsa-miR-4736	CLIP-seq
MIRT2589766	hsa-miR-4740-5p	CLIP-seq
MIRT2589767	hsa-miR-4741	CLIP-seq
MIRT1220490	hsa-miR-4742-5p	CLIP-seq
MIRT2589768	hsa-miR-4753-5p	CLIP-seq
MIRT1220491	hsa-miR-4763-3p	CLIP-seq
MIRT1220510	hsa-miR-4766-5p	CLIP-seq
MIRT2589769	hsa-miR-4778-5p	CLIP-seq
MIRT1220511	hsa-miR-4795-3p	CLIP-seq
MIRT2589770	hsa-miR-4799-3p	CLIP-seq
MIRT2589771	hsa-miR-4804-3p	CLIP-seq
MIRT1220518	hsa-miR-488	CLIP-seq
MIRT2589772	hsa-miR-489	CLIP-seq
MIRT1220512	hsa-miR-494	CLIP-seq
MIRT1220513	hsa-miR-499-3p	CLIP-seq
MIRT1220514	hsa-miR-499a-3p	CLIP-seq
MIRT2589773	hsa-miR-508-5p	CLIP-seq
MIRT2589774	hsa-miR-520d-5p	CLIP-seq
MIRT2589775	hsa-miR-520g	CLIP-seq
MIRT2589776	hsa-miR-520h	CLIP-seq
MIRT2589777	hsa-miR-524-5p	CLIP-seq
MIRT2589778	hsa-miR-541	CLIP-seq
MIRT2589779	hsa-miR-545	CLIP-seq
MIRT1220515	hsa-miR-548c-3p	CLIP-seq
MIRT2063648	hsa-miR-548k	CLIP-seq
MIRT2589780	hsa-miR-548n	CLIP-seq
MIRT2589781	hsa-miR-548p	CLIP-seq
MIRT2589782	hsa-miR-548t	CLIP-seq
MIRT1220524	hsa-miR-548v	CLIP-seq
MIRT2589783	hsa-miR-571	CLIP-seq
MIRT2589784	hsa-miR-590-3p	CLIP-seq
MIRT2063652	hsa-miR-650	CLIP-seq
MIRT2589785	hsa-miR-654-5p	CLIP-seq
MIRT2589786	hsa-miR-657	CLIP-seq
MIRT2589787	hsa-miR-663b	CLIP-seq
MIRT2589788	hsa-miR-676	CLIP-seq
MIRT2589789	hsa-miR-762	CLIP-seq
MIRT2589790	hsa-miR-936	CLIP-seq
MIRT2063653	hsa-miR-940	CLIP-seq
MIRT2589791	hsa-miR-943	CLIP-seq
MIRT2431953	hsa-miR-323-3p	CLIP-seq
MIRT2589792	hsa-miR-4738-3p	CLIP-seq
MIRT2589774	hsa-miR-520d-5p	CLIP-seq
MIRT2589777	hsa-miR-524-5p	CLIP-seq
MIRT2687309	hsa-miR-103a	CLIP-seq
MIRT2687310	hsa-miR-107	CLIP-seq
MIRT2589695	hsa-miR-1179	CLIP-seq
MIRT2589696	hsa-miR-1206	CLIP-seq
MIRT1220468	hsa-miR-1207-5p	CLIP-seq
MIRT2589697	hsa-miR-1227	CLIP-seq
MIRT2589698	hsa-miR-1244	CLIP-seq
MIRT2687311	hsa-miR-1252	CLIP-seq
MIRT2687312	hsa-miR-1261	CLIP-seq
MIRT2589699	hsa-miR-1269	CLIP-seq
MIRT2589700	hsa-miR-1269b	CLIP-seq
MIRT2589701	hsa-miR-1273d	CLIP-seq
MIRT2063628	hsa-miR-1278	CLIP-seq
MIRT2687313	hsa-miR-1284	CLIP-seq
MIRT2589702	hsa-miR-1288	CLIP-seq
MIRT2589703	hsa-miR-1291	CLIP-seq
MIRT2687314	hsa-miR-1305	CLIP-seq
MIRT1220469	hsa-miR-130a	CLIP-seq
MIRT1220470	hsa-miR-130b	CLIP-seq
MIRT2589704	hsa-miR-134	CLIP-seq
MIRT2589705	hsa-miR-140-3p	CLIP-seq
MIRT2589706	hsa-miR-142-3p	CLIP-seq
MIRT2589707	hsa-miR-145	CLIP-seq
MIRT1220471	hsa-miR-148a	CLIP-seq
MIRT1220472	hsa-miR-148b	CLIP-seq
MIRT1220473	hsa-miR-152	CLIP-seq
MIRT2589708	hsa-miR-1587	CLIP-seq
MIRT2063629	hsa-miR-1827	CLIP-seq
MIRT2687315	hsa-miR-1913	CLIP-seq
MIRT2589709	hsa-miR-1914	CLIP-seq
MIRT2589710	hsa-miR-199a-3p	CLIP-seq
MIRT2589711	hsa-miR-199b-3p	CLIP-seq
MIRT2589712	hsa-miR-2054	CLIP-seq
MIRT2063632	hsa-miR-2113	CLIP-seq
MIRT1220492	hsa-miR-221	CLIP-seq
MIRT1220493	hsa-miR-222	CLIP-seq
MIRT2589713	hsa-miR-2355-3p	CLIP-seq
MIRT1220494	hsa-miR-23a	CLIP-seq
MIRT1220495	hsa-miR-23b	CLIP-seq
MIRT1220496	hsa-miR-23c	CLIP-seq
MIRT1220474	hsa-miR-2682	CLIP-seq
MIRT1220475	hsa-miR-298	CLIP-seq
MIRT2687316	hsa-miR-300	CLIP-seq
MIRT1220476	hsa-miR-301a	CLIP-seq
MIRT1220477	hsa-miR-301b	CLIP-seq
MIRT2589714	hsa-miR-3074-5p	CLIP-seq
MIRT2589715	hsa-miR-3118	CLIP-seq
MIRT2589716	hsa-miR-3120-3p	CLIP-seq
MIRT2589717	hsa-miR-3129-5p	CLIP-seq
MIRT2687317	hsa-miR-3152-3p	CLIP-seq
MIRT2687318	hsa-miR-3157-5p	CLIP-seq
MIRT2589718	hsa-miR-3162-3p	CLIP-seq
MIRT1220499	hsa-miR-3163	CLIP-seq
MIRT1220522	hsa-miR-3188	CLIP-seq
MIRT2431953	hsa-miR-323-3p	CLIP-seq
MIRT2687319	hsa-miR-324-3p	CLIP-seq
MIRT2589719	hsa-miR-328	CLIP-seq
MIRT1220500	hsa-miR-340	CLIP-seq
MIRT1220478	hsa-miR-34a	CLIP-seq
MIRT1220479	hsa-miR-34c-5p	CLIP-seq
MIRT1220502	hsa-miR-3545-3p	CLIP-seq
MIRT2589720	hsa-miR-3607-3p	CLIP-seq
MIRT2063635	hsa-miR-3612	CLIP-seq
MIRT2687320	hsa-miR-361-3p	CLIP-seq
MIRT1220523	hsa-miR-361-5p	CLIP-seq
MIRT2687321	hsa-miR-3617	CLIP-seq
MIRT2589721	hsa-miR-3622b-5p	CLIP-seq
MIRT2687322	hsa-miR-3647-3p	CLIP-seq
MIRT2589722	hsa-miR-3654	CLIP-seq
MIRT2589723	hsa-miR-3658	CLIP-seq
MIRT2589724	hsa-miR-3665	CLIP-seq
MIRT1220481	hsa-miR-3666	CLIP-seq
MIRT2589725	hsa-miR-3686	CLIP-seq
MIRT2687323	hsa-miR-3689d	CLIP-seq
MIRT2589726	hsa-miR-370	CLIP-seq
MIRT1220482	hsa-miR-3714	CLIP-seq
MIRT2589727	hsa-miR-375	CLIP-seq
MIRT2589728	hsa-miR-376a	CLIP-seq
MIRT2589729	hsa-miR-376b	CLIP-seq
MIRT2687324	hsa-miR-376c	CLIP-seq
MIRT2687325	hsa-miR-381	CLIP-seq
MIRT2687326	hsa-miR-383	CLIP-seq
MIRT2589730	hsa-miR-3913-3p	CLIP-seq
MIRT2687327	hsa-miR-3922-5p	CLIP-seq
MIRT2589731	hsa-miR-3944-5p	CLIP-seq
MIRT2589732	hsa-miR-3973	CLIP-seq
MIRT2589733	hsa-miR-3975	CLIP-seq
MIRT2589734	hsa-miR-421	CLIP-seq
MIRT2589735	hsa-miR-4255	CLIP-seq
MIRT2063636	hsa-miR-4264	CLIP-seq
MIRT2589736	hsa-miR-4268	CLIP-seq
MIRT2589737	hsa-miR-4270	CLIP-seq
MIRT2687328	hsa-miR-4271	CLIP-seq
MIRT2589738	hsa-miR-4272	CLIP-seq
MIRT1220504	hsa-miR-4277	CLIP-seq
MIRT1220483	hsa-miR-4295	CLIP-seq
MIRT2687329	hsa-miR-4307	CLIP-seq
MIRT1220505	hsa-miR-431	CLIP-seq
MIRT2687330	hsa-miR-4310	CLIP-seq
MIRT2687331	hsa-miR-4313	CLIP-seq
MIRT2687332	hsa-miR-4317	CLIP-seq
MIRT2589739	hsa-miR-4318	CLIP-seq
MIRT2063637	hsa-miR-4328	CLIP-seq
MIRT2589740	hsa-miR-4417	CLIP-seq
MIRT1220506	hsa-miR-4422	CLIP-seq
MIRT2589741	hsa-miR-4441	CLIP-seq
MIRT2063638	hsa-miR-4443	CLIP-seq
MIRT2589742	hsa-miR-4448	CLIP-seq
MIRT2589743	hsa-miR-4459	CLIP-seq
MIRT2063640	hsa-miR-4470	CLIP-seq
MIRT2687333	hsa-miR-4473	CLIP-seq
MIRT2589744	hsa-miR-4492	CLIP-seq
MIRT2589745	hsa-miR-4498	CLIP-seq
MIRT1220484	hsa-miR-449a	CLIP-seq
MIRT1220485	hsa-miR-449b	CLIP-seq
MIRT1220486	hsa-miR-449c	CLIP-seq
MIRT2589746	hsa-miR-4514	CLIP-seq
MIRT2589747	hsa-miR-4515	CLIP-seq
MIRT2063641	hsa-miR-452	CLIP-seq
MIRT2589748	hsa-miR-4528	CLIP-seq
MIRT2589749	hsa-miR-4529-3p	CLIP-seq
MIRT2687334	hsa-miR-4533	CLIP-seq
MIRT1220507	hsa-miR-4539	CLIP-seq
MIRT1220487	hsa-miR-454	CLIP-seq
MIRT2589750	hsa-miR-4638-3p	CLIP-seq
MIRT2589751	hsa-miR-4640-3p	CLIP-seq
MIRT2063642	hsa-miR-4652-3p	CLIP-seq
MIRT2589752	hsa-miR-4653-3p	CLIP-seq
MIRT2589753	hsa-miR-4656	CLIP-seq
MIRT2687335	hsa-miR-4659a-5p	CLIP-seq
MIRT2687336	hsa-miR-4659b-5p	CLIP-seq
MIRT2589754	hsa-miR-4661-3p	CLIP-seq
MIRT2687337	hsa-miR-4666-3p	CLIP-seq
MIRT2687338	hsa-miR-4671-3p	CLIP-seq
MIRT2589755	hsa-miR-4675	CLIP-seq
MIRT2063643	hsa-miR-4676-3p	CLIP-seq
MIRT2589756	hsa-miR-4677-3p	CLIP-seq
MIRT2589757	hsa-miR-4678	CLIP-seq
MIRT2589758	hsa-miR-4679	CLIP-seq
MIRT2687339	hsa-miR-4687-5p	CLIP-seq
MIRT2687340	hsa-miR-4690-3p	CLIP-seq
MIRT2589759	hsa-miR-4692	CLIP-seq
MIRT2687341	hsa-miR-4694-5p	CLIP-seq
MIRT2687342	hsa-miR-4695-3p	CLIP-seq
MIRT2589760	hsa-miR-4695-5p	CLIP-seq
MIRT1220488	hsa-miR-4696	CLIP-seq
MIRT2589761	hsa-miR-4709-5p	CLIP-seq
MIRT2063644	hsa-miR-4711-3p	CLIP-seq
MIRT2687343	hsa-miR-4716-3p	CLIP-seq
MIRT2589762	hsa-miR-4720-3p	CLIP-seq
MIRT2589763	hsa-miR-4720-5p	CLIP-seq
MIRT2589764	hsa-miR-4722-5p	CLIP-seq
MIRT2687344	hsa-miR-4725-3p	CLIP-seq
MIRT1220508	hsa-miR-4728-3p	CLIP-seq
MIRT2589765	hsa-miR-4735-5p	CLIP-seq
MIRT1220489	hsa-miR-4736	CLIP-seq
MIRT2589792	hsa-miR-4738-3p	CLIP-seq
MIRT2589766	hsa-miR-4740-5p	CLIP-seq
MIRT2589767	hsa-miR-4741	CLIP-seq
MIRT1220490	hsa-miR-4742-5p	CLIP-seq
MIRT2687345	hsa-miR-4747-5p	CLIP-seq
MIRT2687346	hsa-miR-4749-3p	CLIP-seq
MIRT2589768	hsa-miR-4753-5p	CLIP-seq
MIRT1220491	hsa-miR-4763-3p	CLIP-seq
MIRT1220510	hsa-miR-4766-5p	CLIP-seq
MIRT2687347	hsa-miR-4772-5p	CLIP-seq
MIRT2687348	hsa-miR-4776-3p	CLIP-seq
MIRT2589769	hsa-miR-4778-5p	CLIP-seq
MIRT1220511	hsa-miR-4795-3p	CLIP-seq
MIRT2063647	hsa-miR-4797-3p	CLIP-seq
MIRT2589770	hsa-miR-4799-3p	CLIP-seq
MIRT2687349	hsa-miR-4802-5p	CLIP-seq
MIRT2589771	hsa-miR-4804-3p	CLIP-seq
MIRT1220518	hsa-miR-488	CLIP-seq
MIRT2589772	hsa-miR-489	CLIP-seq
MIRT2687350	hsa-miR-490-3p	CLIP-seq
MIRT1220512	hsa-miR-494	CLIP-seq
MIRT2687351	hsa-miR-498	CLIP-seq
MIRT1220513	hsa-miR-499-3p	CLIP-seq
MIRT1220514	hsa-miR-499a-3p	CLIP-seq
MIRT2589773	hsa-miR-508-5p	CLIP-seq
MIRT2589774	hsa-miR-520d-5p	CLIP-seq
MIRT2589775	hsa-miR-520g	CLIP-seq
MIRT2589776	hsa-miR-520h	CLIP-seq
MIRT2589777	hsa-miR-524-5p	CLIP-seq
MIRT2589778	hsa-miR-541	CLIP-seq
MIRT2589779	hsa-miR-545	CLIP-seq
MIRT2687352	hsa-miR-548a-5p	CLIP-seq
MIRT2687353	hsa-miR-548ab	CLIP-seq
MIRT2687354	hsa-miR-548ac	CLIP-seq
MIRT2687355	hsa-miR-548ae	CLIP-seq
MIRT2687356	hsa-miR-548aj	CLIP-seq
MIRT2687357	hsa-miR-548ak	CLIP-seq
MIRT2687358	hsa-miR-548am	CLIP-seq
MIRT2687359	hsa-miR-548b-5p	CLIP-seq
MIRT1220515	hsa-miR-548c-3p	CLIP-seq
MIRT2687360	hsa-miR-548c-5p	CLIP-seq
MIRT2687361	hsa-miR-548d-3p	CLIP-seq
MIRT2687362	hsa-miR-548d-5p	CLIP-seq
MIRT2687363	hsa-miR-548h	CLIP-seq
MIRT2687364	hsa-miR-548i	CLIP-seq
MIRT2687365	hsa-miR-548j	CLIP-seq
MIRT2063648	hsa-miR-548k	CLIP-seq
MIRT2589780	hsa-miR-548n	CLIP-seq
MIRT2589781	hsa-miR-548p	CLIP-seq
MIRT2589782	hsa-miR-548t	CLIP-seq
MIRT2687366	hsa-miR-548u	CLIP-seq
MIRT1220524	hsa-miR-548v	CLIP-seq
MIRT2687367	hsa-miR-548w	CLIP-seq
MIRT2687368	hsa-miR-548x	CLIP-seq
MIRT2687369	hsa-miR-548y	CLIP-seq
MIRT2687370	hsa-miR-548z	CLIP-seq
MIRT2687371	hsa-miR-555	CLIP-seq
MIRT2687372	hsa-miR-559	CLIP-seq
MIRT2687373	hsa-miR-570	CLIP-seq
MIRT2589783	hsa-miR-571	CLIP-seq
MIRT2687374	hsa-miR-580	CLIP-seq
MIRT2589784	hsa-miR-590-3p	CLIP-seq
MIRT2063649	hsa-miR-592	CLIP-seq
MIRT2063650	hsa-miR-599	CLIP-seq
MIRT2687375	hsa-miR-602	CLIP-seq
MIRT2687376	hsa-miR-641	CLIP-seq
MIRT2063652	hsa-miR-650	CLIP-seq
MIRT2589785	hsa-miR-654-5p	CLIP-seq
MIRT2589786	hsa-miR-657	CLIP-seq
MIRT2589787	hsa-miR-663b	CLIP-seq
MIRT2589788	hsa-miR-676	CLIP-seq
MIRT2589789	hsa-miR-762	CLIP-seq
MIRT2589790	hsa-miR-936	CLIP-seq
MIRT2063653	hsa-miR-940	CLIP-seq
MIRT2589791	hsa-miR-943	CLIP-seq

Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000930	Component	Gamma-tubulin complex	IEA
GO:0001780	Process	Neutrophil homeostasis	IEA
GO:0001780	Process	Neutrophil homeostasis	ISS
GO:0004114	Function	3',5'-cyclic-nucleotide phosphodiesterase activity	IEA
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	IBA
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	IDA	17404263
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	IEA
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	IGI	8413254
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	ISS
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	TAS	9371714
GO:0005246	Function	Calcium channel regulator activity	IEA
GO:0005246	Function	Calcium channel regulator activity	ISS
GO:0005515	Function	Protein binding	IPI	33961781, 37207277
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005891	Component	Voltage-gated calcium channel complex	IEA
GO:0005891	Component	Voltage-gated calcium channel complex	ISS
GO:0006198	Process	CAMP catabolic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008081	Function	Phosphoric diester hydrolase activity	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030018	Component	Z disc	IEA
GO:0030018	Component	Z disc	ISS
GO:0030552	Function	CAMP binding	IGI	8413254
GO:0030593	Process	Neutrophil chemotaxis	IEA
GO:0030593	Process	Neutrophil chemotaxis	ISS
GO:0032729	Process	Positive regulation of type II interferon production	IMP	17404263
GO:0032743	Process	Positive regulation of interleukin-2 production	IMP	17404263
GO:0043015	Function	Gamma-tubulin binding	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0044325	Function	Transmembrane transporter binding	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0047555	Function	3',5'-cyclic-GMP phosphodiesterase activity	IBA
GO:0050852	Process	T cell receptor signaling pathway	IMP	17404263
GO:0050900	Process	Leukocyte migration	IEA
GO:0050900	Process	Leukocyte migration	ISS
GO:0060076	Component	Excitatory synapse	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	ISS
GO:0071872	Process	Cellular response to epinephrine stimulus	IEA
GO:0071872	Process	Cellular response to epinephrine stimulus	ISS
GO:0071878	Process	Negative regulation of adenylate cyclase-activating adrenergic receptor signaling pathway	IEA
GO:0071878	Process	Negative regulation of adenylate cyclase-activating adrenergic receptor signaling pathway	ISS
GO:0071944	Component	Cell periphery	IEA
GO:0086004	Process	Regulation of cardiac muscle cell contraction	IEA
GO:0086004	Process	Regulation of cardiac muscle cell contraction	ISS
GO:0141162	Process	Negative regulation of cAMP/PKA signal transduction	IBA
GO:1901898	Process	Negative regulation of relaxation of cardiac muscle	IEA
GO:1901898	Process	Negative regulation of relaxation of cardiac muscle	ISS
GO:1902514	Process	Regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	IEA
GO:1902514	Process	Regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	ISS

MIM	HGNC	e!Ensembl
600127	8781	ENSG00000184588

Q07343

Protein name

3',5'-cyclic-AMP phosphodiesterase 4B (EC 3.1.4.53) (DPDE4) (PDE32) (cAMP-specific phosphodiesterase 4B)

Protein function

Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes (PubMed:15260978). May be involved in mediating central nervous system effects of therapeutic agents ranging from antidepressants to antiast

PDB

1F0J , 1RO6 , 1RO9 , 1ROR , 1TB5 , 1XLX , 1XLZ , 1XM4 , 1XM6 , 1XMU , 1XMY , 1XN0 , 1XOS , 1XOT , 1Y2H , 1Y2J , 2CHM , 2QYL , 3D3P , 3FRG , 3G45 , 3GWT , 3HC8 , 3HDZ , 3HMV , 3KKT , 3LY2 , 3O0J , 3O56 , 3O57 , 3W5E , 3WD9 , 4KP6 , 4MYQ , 4NW7 , 4WZI , 4X0F , 5K6J , 5LAQ , 5OHJ , 6BOJ , 8OEG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18100	PDE4_UCR	166 → 281	Phosphodiesterase 4 upstream conserved regions (UCR)	Domain
PF00233	PDEase_I	405 → 646		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, heart, lung and skeletal muscle (PubMed:17519386). Expressed in white blood cells (PubMed:8392015). {ECO:0000269|PubMed:17519386, ECO:0000269|PubMed:8392015}.; TISSUE SPECIFICITY: [Isoform PDE4B5]: Brain-specific is

Sequence

MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVL
HATFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVR
NNFTILTNLHGTSNKRSPAASQPPVSRVNPQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLG
ETDIDIATEDKSPVDT

Sequence length

736

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Metabolic pathways cAMP signaling pathway Parathyroid hormone synthesis, secretion and action Morphine addiction		DARPP-32 events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (43)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (98)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	30188895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	15331441, 25576220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	21184794, 30229893, 31116379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	21184794, 30229893, 31116379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	GWASCAT_DG	31116379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	30181004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	30181004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	CTD_human_DG	21912604		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	18090323		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	18090323		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	15331441		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21742807, 25576220, 26503641, 30528730, 31138843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	17417055, 18394866, 19350560		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	17417055, 18394866, 18785206, 19350560		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	18394866		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	29061142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29061142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	11839681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28201975, 30413022		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	30800055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31730855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	31730855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30188895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22830422, 30528730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22830422	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27927168, 39202484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	25546171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	Pubtator	25546171	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	Pubtator	25546171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	18394866		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	17481393, 17823207, 18090323, 21184794, 30229893		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	17823207, 18090323, 21184794, 21376063, 21458469		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	19300510	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Atopic	Atopic dermatitis	Pubtator	36142206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	29867490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18599519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35046895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	15331441, 19369227, 21742807, 25576220, 26503641, 30528730, 31138843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disturbance in mood	Mood Disorder	BEFREE	25546171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	25546171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25546171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	29867490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34294701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29100790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	GWASCAT_DG	31527586		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart disease	Pubtator	35899614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	35446883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31730855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	18599519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	20147583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	25546171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	29061142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	22293537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	27210814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26503641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	23451206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18785206		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	29061142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15331441, 31138843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30188895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	18394866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	18394866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	17481393, 17823207, 18090323, 21184794, 30229893		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	17823207, 18090323, 21184794, 21376063, 21458469		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	16293762, 17417055, 17823207, 21184794, 21416589, 25546171, 27468165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	17417055, 30116032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	25546171, 30116032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	30116032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31035240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	33354250, 35899614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15331441, 21742807, 25979379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	22293537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21416589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	21184794		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	33522352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25979379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26806620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	26806620	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	19300510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	21520048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16293762, 16814262, 17258902, 17417055, 17823207, 18090323, 18329668, 18394866, 18785206, 18829870, 19251251, 19350560, 20436352, 21195721, 21876540 View all (5 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	16293762, 18394866		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	17417055, 17823207, 18394866		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	19251251, 21876540, 25546171, 29142105, 31176952	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764, 28991256, 30285260		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	28356347, 28888661, 30131240, 30131242		★★★★★ ★☆☆☆☆ Found in Text Mining only
stress related disorder	Stress Disorder	GWASCAT_DG	31116379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	21670503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular disease	Pubtator	25546171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	18785206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	21670503, 22047792		★★★★★ ★☆☆☆☆ Found in Text Mining only

PDE4B (phosphodiesterase 4B)