PDE4A (phosphodiesterase 4A)

Gene

• Entrez ID: 5141
• Gene name: Phosphodiesterase 4A
• Gene symbol: PDE4A
• Synonyms (NCBI Gene): DPDE2, PDE4, PDE46
• Chromosome: 19
• Chromosome location: 19p13.2
• Summary: The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE4 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular sign

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016809	hsa-miR-335-5p	Microarray	18185580
MIRT040823	hsa-miR-18a-3p	CLASH	23622248
MIRT037515	hsa-miR-744-5p	CLASH	23622248
MIRT709572	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT709571	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT709570	hsa-miR-874-5p	HITS-CLIP	19536157
MIRT709569	hsa-miR-4313	HITS-CLIP	19536157
MIRT492804	hsa-miR-4779	PAR-CLIP	20371350
MIRT492803	hsa-miR-6760-5p	PAR-CLIP	20371350
MIRT492802	hsa-miR-4419a	PAR-CLIP	20371350
MIRT492801	hsa-miR-4510	PAR-CLIP	20371350
MIRT492800	hsa-miR-6127	PAR-CLIP	20371350
MIRT492799	hsa-miR-6129	PAR-CLIP	20371350
MIRT492798	hsa-miR-6130	PAR-CLIP	20371350
MIRT492797	hsa-miR-6133	PAR-CLIP	20371350
MIRT492793	hsa-miR-765	PAR-CLIP	20371350
MIRT492792	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT492791	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT492790	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT492789	hsa-miR-4649-5p	PAR-CLIP	20371350
MIRT492788	hsa-miR-6729-5p	PAR-CLIP	20371350
MIRT492787	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT492807	hsa-miR-1911-3p	PAR-CLIP	20371350
MIRT492806	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT492805	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT492804	hsa-miR-4779	PAR-CLIP	20371350
MIRT492803	hsa-miR-6760-5p	PAR-CLIP	20371350
MIRT569132	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT492802	hsa-miR-4419a	PAR-CLIP	20371350
MIRT492801	hsa-miR-4510	PAR-CLIP	20371350
MIRT492800	hsa-miR-6127	PAR-CLIP	20371350
MIRT492799	hsa-miR-6129	PAR-CLIP	20371350
MIRT492798	hsa-miR-6130	PAR-CLIP	20371350
MIRT492797	hsa-miR-6133	PAR-CLIP	20371350
MIRT492796	hsa-miR-185-5p	PAR-CLIP	20371350
MIRT492795	hsa-miR-4306	PAR-CLIP	20371350
MIRT492794	hsa-miR-4644	PAR-CLIP	20371350
MIRT492793	hsa-miR-765	PAR-CLIP	20371350
MIRT492792	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT492791	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT149366	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT149377	hsa-miR-8085	PAR-CLIP	20371350
MIRT492790	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT492789	hsa-miR-4649-5p	PAR-CLIP	20371350
MIRT492788	hsa-miR-6729-5p	PAR-CLIP	20371350
MIRT492787	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT149369	hsa-miR-6846-5p	PAR-CLIP	20371350
MIRT149370	hsa-miR-6848-5p	PAR-CLIP	20371350
MIRT492807	hsa-miR-1911-3p	PAR-CLIP	23592263
MIRT492806	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT492805	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT492804	hsa-miR-4779	PAR-CLIP	23592263
MIRT492803	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT492802	hsa-miR-4419a	PAR-CLIP	23592263
MIRT492801	hsa-miR-4510	PAR-CLIP	23592263
MIRT492800	hsa-miR-6127	PAR-CLIP	23592263
MIRT492799	hsa-miR-6129	PAR-CLIP	23592263
MIRT492798	hsa-miR-6130	PAR-CLIP	23592263
MIRT492797	hsa-miR-6133	PAR-CLIP	23592263
MIRT492796	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT492795	hsa-miR-4306	PAR-CLIP	23592263
MIRT492794	hsa-miR-4644	PAR-CLIP	23592263
MIRT492793	hsa-miR-765	PAR-CLIP	23592263
MIRT492792	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT492791	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT149366	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT149377	hsa-miR-8085	PAR-CLIP	23592263
MIRT492790	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT492789	hsa-miR-4649-5p	PAR-CLIP	23592263
MIRT492788	hsa-miR-6729-5p	PAR-CLIP	23592263
MIRT492787	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT149369	hsa-miR-6846-5p	PAR-CLIP	23592263
MIRT149370	hsa-miR-6848-5p	PAR-CLIP	23592263
MIRT149309	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT149310	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT726988	hsa-miR-26b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26493444
MIRT569132	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT709572	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT709571	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT709570	hsa-miR-874-5p	HITS-CLIP	19536157
MIRT709569	hsa-miR-4313	HITS-CLIP	19536157
MIRT492804	hsa-miR-4779	PAR-CLIP	20371350
MIRT492803	hsa-miR-6760-5p	PAR-CLIP	20371350
MIRT492802	hsa-miR-4419a	PAR-CLIP	20371350
MIRT492801	hsa-miR-4510	PAR-CLIP	20371350
MIRT492800	hsa-miR-6127	PAR-CLIP	20371350
MIRT492799	hsa-miR-6129	PAR-CLIP	20371350
MIRT492798	hsa-miR-6130	PAR-CLIP	20371350
MIRT492797	hsa-miR-6133	PAR-CLIP	20371350
MIRT492793	hsa-miR-765	PAR-CLIP	20371350
MIRT492792	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT492791	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT492790	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT492789	hsa-miR-4649-5p	PAR-CLIP	20371350
MIRT492788	hsa-miR-6729-5p	PAR-CLIP	20371350
MIRT492787	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT492807	hsa-miR-1911-3p	PAR-CLIP	20371350
MIRT492806	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT492805	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT492804	hsa-miR-4779	PAR-CLIP	20371350
MIRT492803	hsa-miR-6760-5p	PAR-CLIP	20371350
MIRT569132	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT492802	hsa-miR-4419a	PAR-CLIP	20371350
MIRT492801	hsa-miR-4510	PAR-CLIP	20371350
MIRT492800	hsa-miR-6127	PAR-CLIP	20371350
MIRT492799	hsa-miR-6129	PAR-CLIP	20371350
MIRT492798	hsa-miR-6130	PAR-CLIP	20371350
MIRT492797	hsa-miR-6133	PAR-CLIP	20371350
MIRT492796	hsa-miR-185-5p	PAR-CLIP	20371350
MIRT492795	hsa-miR-4306	PAR-CLIP	20371350
MIRT492794	hsa-miR-4644	PAR-CLIP	20371350
MIRT492793	hsa-miR-765	PAR-CLIP	20371350
MIRT492792	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT492791	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT149366	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT149377	hsa-miR-8085	PAR-CLIP	20371350
MIRT492790	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT492789	hsa-miR-4649-5p	PAR-CLIP	20371350
MIRT492788	hsa-miR-6729-5p	PAR-CLIP	20371350
MIRT492787	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT149369	hsa-miR-6846-5p	PAR-CLIP	20371350
MIRT149370	hsa-miR-6848-5p	PAR-CLIP	20371350
MIRT492807	hsa-miR-1911-3p	PAR-CLIP	23592263
MIRT492806	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT492805	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT492804	hsa-miR-4779	PAR-CLIP	23592263
MIRT492803	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT492802	hsa-miR-4419a	PAR-CLIP	23592263
MIRT492801	hsa-miR-4510	PAR-CLIP	23592263
MIRT492800	hsa-miR-6127	PAR-CLIP	23592263
MIRT492799	hsa-miR-6129	PAR-CLIP	23592263
MIRT492798	hsa-miR-6130	PAR-CLIP	23592263
MIRT492797	hsa-miR-6133	PAR-CLIP	23592263
MIRT492796	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT492795	hsa-miR-4306	PAR-CLIP	23592263
MIRT492794	hsa-miR-4644	PAR-CLIP	23592263
MIRT492793	hsa-miR-765	PAR-CLIP	23592263
MIRT492792	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT492791	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT149366	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT149377	hsa-miR-8085	PAR-CLIP	23592263
MIRT492790	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT492789	hsa-miR-4649-5p	PAR-CLIP	23592263
MIRT492788	hsa-miR-6729-5p	PAR-CLIP	23592263
MIRT492787	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT149369	hsa-miR-6846-5p	PAR-CLIP	23592263
MIRT149370	hsa-miR-6848-5p	PAR-CLIP	23592263
MIRT1220378	hsa-miR-1254	CLIP-seq
MIRT1220379	hsa-miR-3116	CLIP-seq
MIRT1220380	hsa-miR-3652	CLIP-seq
MIRT1220381	hsa-miR-3937	CLIP-seq
MIRT1220382	hsa-miR-4430	CLIP-seq
MIRT1220383	hsa-miR-4499	CLIP-seq
MIRT1220384	hsa-miR-4731-3p	CLIP-seq
MIRT1220385	hsa-miR-4797-5p	CLIP-seq
MIRT1220386	hsa-miR-4801	CLIP-seq
MIRT1220387	hsa-miR-600	CLIP-seq
MIRT1220388	hsa-miR-646	CLIP-seq
MIRT1220389	hsa-miR-7	CLIP-seq
MIRT1220390	hsa-miR-1228	CLIP-seq
MIRT1220391	hsa-miR-1303	CLIP-seq
MIRT1220392	hsa-miR-19a	CLIP-seq
MIRT1220393	hsa-miR-19b	CLIP-seq
MIRT1220394	hsa-miR-204	CLIP-seq
MIRT1220395	hsa-miR-211	CLIP-seq
MIRT1220396	hsa-miR-3157-5p	CLIP-seq
MIRT1220397	hsa-miR-3173-3p	CLIP-seq
MIRT1220398	hsa-miR-3175	CLIP-seq
MIRT1220399	hsa-miR-3202	CLIP-seq
MIRT1220400	hsa-miR-3978	CLIP-seq
MIRT1220401	hsa-miR-4433	CLIP-seq
MIRT1220402	hsa-miR-4446-5p	CLIP-seq
MIRT1220403	hsa-miR-4691-3p	CLIP-seq
MIRT1220404	hsa-miR-4695-5p	CLIP-seq
MIRT1220405	hsa-miR-4747-5p	CLIP-seq
MIRT1220406	hsa-miR-4755-5p	CLIP-seq
MIRT1220407	hsa-miR-4758-3p	CLIP-seq
MIRT1220408	hsa-miR-4795-5p	CLIP-seq
MIRT1220409	hsa-miR-623	CLIP-seq
MIRT1220410	hsa-miR-665	CLIP-seq
MIRT1220389	hsa-miR-7	CLIP-seq
MIRT1220411	hsa-miR-877	CLIP-seq
MIRT1220378	hsa-miR-1254	CLIP-seq
MIRT1220412	hsa-miR-1270	CLIP-seq
MIRT1220413	hsa-miR-1275	CLIP-seq
MIRT1220414	hsa-miR-132	CLIP-seq
MIRT1220415	hsa-miR-135a	CLIP-seq
MIRT1220416	hsa-miR-135b	CLIP-seq
MIRT1220417	hsa-miR-185	CLIP-seq
MIRT1220418	hsa-miR-1913	CLIP-seq
MIRT1220392	hsa-miR-19a	CLIP-seq
MIRT1220393	hsa-miR-19b	CLIP-seq
MIRT1220419	hsa-miR-212	CLIP-seq
MIRT1220420	hsa-miR-298	CLIP-seq
MIRT1220379	hsa-miR-3116	CLIP-seq
MIRT1220421	hsa-miR-3124-3p	CLIP-seq
MIRT1220422	hsa-miR-3138	CLIP-seq
MIRT1220423	hsa-miR-3153	CLIP-seq
MIRT1220424	hsa-miR-3158-5p	CLIP-seq
MIRT1220425	hsa-miR-3163	CLIP-seq
MIRT1220426	hsa-miR-3184	CLIP-seq
MIRT1220427	hsa-miR-3189-5p	CLIP-seq
MIRT1220428	hsa-miR-3190	CLIP-seq
MIRT1220399	hsa-miR-3202	CLIP-seq
MIRT1220429	hsa-miR-324-3p	CLIP-seq
MIRT1220430	hsa-miR-34a	CLIP-seq
MIRT1220431	hsa-miR-34c-5p	CLIP-seq
MIRT1220432	hsa-miR-3609	CLIP-seq
MIRT1220433	hsa-miR-3613-3p	CLIP-seq
MIRT1220434	hsa-miR-361-3p	CLIP-seq
MIRT1220435	hsa-miR-3647-3p	CLIP-seq
MIRT1220380	hsa-miR-3652	CLIP-seq
MIRT1220436	hsa-miR-3667-3p	CLIP-seq
MIRT1220381	hsa-miR-3937	CLIP-seq
MIRT1220437	hsa-miR-3973	CLIP-seq
MIRT1220400	hsa-miR-3978	CLIP-seq
MIRT1220438	hsa-miR-423-5p	CLIP-seq
MIRT1220439	hsa-miR-4252	CLIP-seq
MIRT1220440	hsa-miR-4267	CLIP-seq
MIRT1220441	hsa-miR-4271	CLIP-seq
MIRT1220442	hsa-miR-4278	CLIP-seq
MIRT1220443	hsa-miR-4282	CLIP-seq
MIRT1220444	hsa-miR-432	CLIP-seq
MIRT1220382	hsa-miR-4430	CLIP-seq
MIRT1220401	hsa-miR-4433	CLIP-seq
MIRT1220445	hsa-miR-4447	CLIP-seq
MIRT1220446	hsa-miR-4472	CLIP-seq
MIRT1220383	hsa-miR-4499	CLIP-seq
MIRT1220447	hsa-miR-449a	CLIP-seq
MIRT1220448	hsa-miR-449b	CLIP-seq
MIRT1220449	hsa-miR-4525	CLIP-seq
MIRT1220450	hsa-miR-4531	CLIP-seq
MIRT1220451	hsa-miR-4533	CLIP-seq
MIRT1220452	hsa-miR-4665-5p	CLIP-seq
MIRT1220453	hsa-miR-4668-3p	CLIP-seq
MIRT1220454	hsa-miR-4710	CLIP-seq
MIRT1220455	hsa-miR-4716-3p	CLIP-seq
MIRT1220456	hsa-miR-4723-5p	CLIP-seq
MIRT1220457	hsa-miR-4725-3p	CLIP-seq
MIRT1220458	hsa-miR-4728-5p	CLIP-seq
MIRT1220384	hsa-miR-4731-3p	CLIP-seq
MIRT1220459	hsa-miR-4746-5p	CLIP-seq
MIRT1220405	hsa-miR-4747-5p	CLIP-seq
MIRT1220407	hsa-miR-4758-3p	CLIP-seq
MIRT1220408	hsa-miR-4795-5p	CLIP-seq
MIRT1220460	hsa-miR-4796-3p	CLIP-seq
MIRT1220385	hsa-miR-4797-5p	CLIP-seq
MIRT1220386	hsa-miR-4801	CLIP-seq
MIRT1220461	hsa-miR-486-3p	CLIP-seq
MIRT1220462	hsa-miR-520g	CLIP-seq
MIRT1220463	hsa-miR-520h	CLIP-seq
MIRT1220464	hsa-miR-548ah	CLIP-seq
MIRT1220387	hsa-miR-600	CLIP-seq
MIRT1220465	hsa-miR-605	CLIP-seq
MIRT1220466	hsa-miR-620	CLIP-seq
MIRT1220467	hsa-miR-625	CLIP-seq
MIRT1220388	hsa-miR-646	CLIP-seq
MIRT1220410	hsa-miR-665	CLIP-seq
MIRT1220389	hsa-miR-7	CLIP-seq
MIRT1220402	hsa-miR-4446-5p	CLIP-seq
MIRT2292098	hsa-miR-3135b	CLIP-seq
MIRT1220399	hsa-miR-3202	CLIP-seq
MIRT1220380	hsa-miR-3652	CLIP-seq
MIRT1220382	hsa-miR-4430	CLIP-seq
MIRT2292099	hsa-miR-4487	CLIP-seq
MIRT2292100	hsa-miR-4633-3p	CLIP-seq
MIRT1220422	hsa-miR-3138	CLIP-seq
MIRT2456079	hsa-miR-122	CLIP-seq
MIRT2456080	hsa-miR-1324	CLIP-seq
MIRT2456081	hsa-miR-3159	CLIP-seq
MIRT2456082	hsa-miR-486-5p	CLIP-seq
MIRT2456083	hsa-miR-95	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004114	Function	3',5'-cyclic-nucleotide phosphodiesterase activity	IEA
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	IBA
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	IDA	7888306, 9677330, 11306681, 17404263, 18095939
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	IEA
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	IGI	8413254
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	TAS	9677330
GO:0005515	Function	Protein binding	IPI	11306681, 32296183, 32814053
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	7888306, 18095939
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0006198	Process	CAMP catabolic process	IDA	7888306, 9677330, 11306681, 18095939
GO:0006198	Process	CAMP catabolic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	8940140
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007608	Process	Sensory perception of smell	IEA
GO:0008081	Function	Phosphoric diester hydrolase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9677330
GO:0016787	Function	Hydrolase activity	IEA
GO:0019898	Component	Extrinsic component of membrane	IDA	9677330, 18095939
GO:0030552	Function	CAMP binding	IGI	8413254
GO:0032587	Component	Ruffle membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0047555	Function	3',5'-cyclic-GMP phosphodiesterase activity	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	11306681
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0106070	Process	Regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0141161	Process	Regulation of cAMP/PKA signal transduction	IEA
GO:0141162	Process	Negative regulation of cAMP/PKA signal transduction	IBA

Other IDs

• MIM: 600126
• HGNC: 8780
• e!Ensembl: ENSG00000065989

Protein

• UniProt ID: P27815
• Protein name: 3',5'-cyclic-AMP phosphodiesterase 4A (EC 3.1.4.53) (DPDE2) (PDE46) (cAMP-specific phosphodiesterase 4A)
• Protein function: Hydrolyzes the second messenger 3',5'-cyclic AMP (cAMP), which is a key regulator of many important physiological processes. ; [Isoform 1]: Efficiently hydrolyzes cAMP. {ECO:000
• PDB: 2QYK, 3I8V, 3TVX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18100	PDE4_UCR	178 → 293	Phosphodiesterase 4 upstream conserved regions (UCR)	Domain
  PF00233	PDEase_I	432 → 673		Domain

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 1]: Expressed in lymphoid cell subsets including CD8-positive T cells and T-helper 2 cells. Expressed in dendritic cells. {ECO:0000269|PubMed:15738310}.; TISSUE SPECIFICITY: [Isoform 2]: Highly expressed in liver, stomach, tes
• Sequence:

  MEPPTVPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYSDSAERAERERQ
  PHRPIERADAMDTSDRPGLRTTRMSWPSSFHGTGTGSGGAGGGSSRRFEAENGPTPSPGR
  SPLDSQASPGLVLHAGAATSQRRESFLYRSDSDYDMSPKTMSRNSSVTSEAHAEDLIVTP
  FAQVLASLRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEELDW
  CLEQLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEI
  PSPTMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKTD
  QEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYML
  TLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGV
  SNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDM
  VLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLE
  LYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADL
  VHPDAQEILDTLEDNRDWYYSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEEE
  ISMAQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQESLEVMAQEASLEAELEAVYLT
  QQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGLP
  STAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGGGSGGDPT

• Sequence length: 886

Pathways

KEGG:

Purine metabolism
Metabolic pathways
cAMP signaling pathway
Parathyroid hormone synthesis, secretion and action
Morphine addiction

Reactome:

DARPP-32 events
G alpha (s) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL AFFECTIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acrodysostosis	Acrodysostosis	BEFREE	25064455, 27908835		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	30809467		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	31081957		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10509746		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18591513, 35229272	Associate	★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	28054669		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	28263187		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28748375		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28748375		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25640159		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	30181004	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28554321, 29388335, 30124722, 30181004, 30626658, 30909370, 31317423		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10730545, 16427796, 19426955, 19596983, 21047676, 22101762, 27608741, 28432317, 28558784, 29201082, 29291443, 30474934, 30716315, 30722707, 31474120, 8541027		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	15681504, 32447834	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25640159		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	29778625		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	18090323		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	18090323		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30474934		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30528730, 31138843		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	14615375, 17699872		★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	29197324		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	19018233		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	19018233		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Diseases	Bone disease	Pubtator	17900349	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	19047098		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28755423		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28755423, 28971320	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	21784969		★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	BEFREE	30759374		★☆☆☆☆ Found in Text Mining only
Bronchitis Chronic	Bronchitis	Pubtator	32197620, 33295083	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	28201975, 31664853		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25122068		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29348829		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	18591513	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24925970, 26671126, 28836502		★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	20124930		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30416389, 31639651		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	26671126, 30416389, 30474934		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	11839681		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14615375, 17699872, 19380787, 28867658, 29246942		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15047569, 16427796, 22360706, 23043089, 26416856, 26484898, 27608741, 27917591, 28201975, 28432317, 28451841, 28523172, 29200281, 29201082, 29291443, 29397527, 29502338, 29648516, 30394213, 30395484, 30610438, 30682248, 30716315, 30851246, 31319374, 31399091, 31798449		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	15047569		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	27890378, 29155261, 30140804, 30588755, 31704172		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28402318, 30087608, 30536081		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22830422, 30867802		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22830422	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	BEFREE	9893113		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29939224, 30967774		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	35899614	Associate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	25546171		★☆☆☆☆ Found in Text Mining only
Cystic kidney	Cystic Kidney Disease	BEFREE	28750036		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17900349		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	17481393, 18090323, 23003922, 28748375, 29197324, 30588755, 31076569		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	17700644, 18060387, 18090323, 22487514, 23003922		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Atopic	Atopic dermatitis	Pubtator	37156706	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	28290219, 28492291, 28554321, 28681318, 28709568, 28887947, 28895956, 29063440, 29076116, 29248522, 29353721, 29812961, 29930242, 30058384, 30332502, 30386231, 30916723, 31002539, 31494188		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	29593534, 30883697, 30951898		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	29713919		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	15331441, 26503641, 29246942		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	28290219, 28492291, 28554321, 28681318, 28709568, 28887947, 28895956, 29063440, 29076116, 29248522, 29353721, 29812961, 29930242, 30058384, 30332502, 30386231, 30916723, 31002539, 31494188		★☆☆☆☆ Found in Text Mining only
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	BEFREE	30824285		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28771997		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28771997		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28771997	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34190001	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30858122		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28202289		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28202289		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29939224, 30967774		★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	30136871		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	14751289, 28263187, 29175000		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	GWASDB_DG	22968135		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	9515164		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	12930888, 28235598, 28402318, 29175000, 30087608, 30536081, 31660837, 31737188		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28554321, 28617319		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30416389, 30797872		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	27521329		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12531792	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36436494	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	27521329		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27859531, 30026835		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	30026835		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	27210814	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	20082309, 28523172, 29307855, 29602314		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	28477089		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	28684234		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21742807		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	19018233, 22677471, 23129425, 27725657		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28755423		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28771997		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25122068		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29348829		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24518597		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15331441, 17699872, 21742807, 27542768, 29246942, 30809467		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17390056, 28092671		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	17481393, 18090323, 28748375, 29197324, 30588755, 31076569		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	17481393, 17700644, 18060387, 18090323, 22487514		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	28263187		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30227388		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31299169		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	28772081		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	28054669		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	36571271	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	28798156		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	27521329		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	35899614	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20551058, 25301721, 28202289, 29246942, 30528730		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23003922, 31642904		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	30395484		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	27917591		★☆☆☆☆ Found in Text Mining only
Optic Nerve Glioma	Optic Nerve Glioma	BEFREE	20551058		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	17900349	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	12782945		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29348829		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37427586	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28701494, 30822711, 30824285		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	29475134, 30824285	Associate	★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	14996430		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28167453		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24518597		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	25574825		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	26806620, 28499587, 28554321, 29469962, 29593534, 29812961, 30851246, 30909370, 31099559		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	11522597, 15681504, 16807266, 23043089, 32021151, 32197620, 33295083, 34771000, 37192443	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	30809467		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29216750		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	28201975, 29200281, 29407945		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	12930888		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21342916, 30474934		★☆☆☆☆ Found in Text Mining only
Rothmund-Thomson syndrome	Rothmund-Thomson Syndrome	BEFREE	12930888		★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	31317423		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	18060387, 21898905		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	18090323, 18998737, 19018233, 21898905, 30536081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	PSYGENET_DG	18245171		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29710495		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	30417279		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28209630		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30883697		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	19018233, 23129425		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	25640159, 26484898		★☆☆☆☆ Found in Text Mining only