NOL7 (nucleolar protein 7)

Gene

• Entrez ID: 51406
• Gene name: Nucleolar protein 7
• Gene symbol: NOL7
• Synonyms (NCBI Gene): C6orf90, PQBP3, RARG-1, dJ223E5.2
• Chromosome: 6
• Chromosome location: 6p23
• Summary: The protein encoded by this gene localizes to the nucleolus, where it maintains nucleolar structure and cell growth rates. The encoded protein also functions as a tumor suppressor and regulator of angiogenesis. The RB tumor suppressor gene recruits transc

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT041829	hsa-miR-484	CLASH	23622248
MIRT1188675	hsa-miR-1179	CLIP-seq
MIRT1188676	hsa-miR-1284	CLIP-seq
MIRT1188677	hsa-miR-3973	CLIP-seq
MIRT1188678	hsa-miR-4729	CLIP-seq
MIRT1188679	hsa-miR-520d-5p	CLIP-seq
MIRT1188680	hsa-miR-524-5p	CLIP-seq
MIRT1188681	hsa-miR-548k	CLIP-seq
MIRT1188682	hsa-miR-577	CLIP-seq
MIRT1188683	hsa-miR-579	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYC	Activation	20206243
RXRA	Activation	20206243
SP1	Unknown	20206243

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IDA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0030490	Process	Maturation of SSU-rRNA	IMP	37246770
GO:0032040	Component	Small-subunit processome	IDA	34516797
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042274	Process	Ribosomal small subunit biogenesis	IDA	34516797

Other IDs

• MIM: 611533
• HGNC: 21040
• e!Ensembl: ENSG00000225921

Protein

• UniProt ID: Q9UMY1
• Protein name: U3 small nucleolar RNA-associated protein NOL7 (U3 snoRNA-associated protein NOL7) (Nucleolar protein 7) (Nucleolar protein of 27 kDa)
• Protein function: Functions as part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit that coordinates the first two steps of ribosome biogenesis in transcription of the primary transcript pre-RNA and pre-18S process
• PDB: 7MQ8, 7MQ9, 7MQA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08157	NUC129	172 → 234	NUC129 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in numerous tissues. Particularly prevalent in the adrenal gland, thyroid gland, heart and skeletal muscle. {ECO:0000269|PubMed:16205646}.
• Sequence:

  MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGLLLGQPSSGAAAEPLEEDEEGDDEFD
  DEAPEELTFASAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKLLPDTILE
  KLTTASQTNIKKSPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQ
  DLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFLSLANKRLPVKRAAVQFLNNAWGIQKKQN
  AKRFKRRWMVRKMKTKK

• Sequence length: 257

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	36077008	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36077008	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36077008	Stimulate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	16205646, 22123719		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	16205646, 22123719		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36077008	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23308053		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	16205646, 22123719		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16205646, 22123719, 23085760, 23308053		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	36077008	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23308053		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36077008	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36077008	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22123719	Associate	★☆☆☆☆ Found in Text Mining only