Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5140
Gene name	Phosphodiesterase 3B
Gene symbol	PDE3B
Synonyms (NCBI Gene)	HcGIP1cGIPDE1
Chromosome	11
Chromosome location	11p15.2

185

Show/Hide all (185)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020264	hsa-miR-130b-3p	Sequencing	20371350
MIRT022058	hsa-miR-128-3p	Microarray	17612493
MIRT022763	hsa-miR-124-3p	Microarray	18668037
MIRT028148	hsa-miR-93-5p	Sequencing	20371350
MIRT051238	hsa-miR-16-5p	CLASH	23622248
MIRT443672	hsa-miR-562	PAR-CLIP	22100165
MIRT443672	hsa-miR-562	PAR-CLIP	22100165
MIRT1220285	hsa-miR-103a	CLIP-seq
MIRT1220286	hsa-miR-106a	CLIP-seq
MIRT1220287	hsa-miR-106b	CLIP-seq
MIRT1220288	hsa-miR-107	CLIP-seq
MIRT1220289	hsa-miR-1202	CLIP-seq
MIRT1220290	hsa-miR-1245	CLIP-seq
MIRT1220291	hsa-miR-128	CLIP-seq
MIRT1220292	hsa-miR-1290	CLIP-seq
MIRT1220293	hsa-miR-144	CLIP-seq
MIRT1220294	hsa-miR-153	CLIP-seq
MIRT1220295	hsa-miR-15a	CLIP-seq
MIRT1220296	hsa-miR-15b	CLIP-seq
MIRT1220297	hsa-miR-16	CLIP-seq
MIRT1220298	hsa-miR-17	CLIP-seq
MIRT1220299	hsa-miR-1912	CLIP-seq
MIRT1220300	hsa-miR-1914	CLIP-seq
MIRT1220301	hsa-miR-195	CLIP-seq
MIRT1220302	hsa-miR-2053	CLIP-seq
MIRT1220303	hsa-miR-20a	CLIP-seq
MIRT1220304	hsa-miR-20b	CLIP-seq
MIRT1220305	hsa-miR-223	CLIP-seq
MIRT1220306	hsa-miR-25	CLIP-seq
MIRT1220307	hsa-miR-27a	CLIP-seq
MIRT1220308	hsa-miR-27b	CLIP-seq
MIRT1220309	hsa-miR-3120-3p	CLIP-seq
MIRT1220310	hsa-miR-3130-5p	CLIP-seq
MIRT1220311	hsa-miR-3167	CLIP-seq
MIRT1220312	hsa-miR-3183	CLIP-seq
MIRT1220313	hsa-miR-3194-5p	CLIP-seq
MIRT1220314	hsa-miR-32	CLIP-seq
MIRT1220315	hsa-miR-320a	CLIP-seq
MIRT1220316	hsa-miR-320b	CLIP-seq
MIRT1220317	hsa-miR-320c	CLIP-seq
MIRT1220318	hsa-miR-320d	CLIP-seq
MIRT1220319	hsa-miR-330-3p	CLIP-seq
MIRT1220320	hsa-miR-33a	CLIP-seq
MIRT1220321	hsa-miR-33b	CLIP-seq
MIRT1220322	hsa-miR-342-3p	CLIP-seq
MIRT1220323	hsa-miR-3606	CLIP-seq
MIRT1220324	hsa-miR-363	CLIP-seq
MIRT1220325	hsa-miR-367	CLIP-seq
MIRT1220326	hsa-miR-3670	CLIP-seq
MIRT1220327	hsa-miR-3972	CLIP-seq
MIRT1220328	hsa-miR-3973	CLIP-seq
MIRT1220329	hsa-miR-424	CLIP-seq
MIRT1220330	hsa-miR-425	CLIP-seq
MIRT1220331	hsa-miR-4310	CLIP-seq
MIRT1220332	hsa-miR-4429	CLIP-seq
MIRT1220333	hsa-miR-4434	CLIP-seq
MIRT1220334	hsa-miR-4468	CLIP-seq
MIRT1220335	hsa-miR-4477a	CLIP-seq
MIRT1220336	hsa-miR-4481	CLIP-seq
MIRT1220337	hsa-miR-4482	CLIP-seq
MIRT1220338	hsa-miR-4509	CLIP-seq
MIRT1220339	hsa-miR-4516	CLIP-seq
MIRT1220340	hsa-miR-4530	CLIP-seq
MIRT1220341	hsa-miR-4531	CLIP-seq
MIRT1220342	hsa-miR-4661-3p	CLIP-seq
MIRT1220343	hsa-miR-4666-5p	CLIP-seq
MIRT1220344	hsa-miR-4693-3p	CLIP-seq
MIRT1220345	hsa-miR-4704-5p	CLIP-seq
MIRT1220346	hsa-miR-4711-5p	CLIP-seq
MIRT1220347	hsa-miR-4717-3p	CLIP-seq
MIRT1220348	hsa-miR-4723-3p	CLIP-seq
MIRT1220349	hsa-miR-4724-5p	CLIP-seq
MIRT1220350	hsa-miR-4744	CLIP-seq
MIRT1220351	hsa-miR-4745-5p	CLIP-seq
MIRT1220352	hsa-miR-4753-5p	CLIP-seq
MIRT1220353	hsa-miR-4775	CLIP-seq
MIRT1220354	hsa-miR-4789-5p	CLIP-seq
MIRT1220355	hsa-miR-4790-3p	CLIP-seq
MIRT1220356	hsa-miR-4802-5p	CLIP-seq
MIRT1220357	hsa-miR-497	CLIP-seq
MIRT1220358	hsa-miR-501-3p	CLIP-seq
MIRT1220359	hsa-miR-502-3p	CLIP-seq
MIRT1220360	hsa-miR-519a	CLIP-seq
MIRT1220361	hsa-miR-519b-3p	CLIP-seq
MIRT1220362	hsa-miR-519c-3p	CLIP-seq
MIRT1220363	hsa-miR-519d	CLIP-seq
MIRT1220364	hsa-miR-545	CLIP-seq
MIRT1220365	hsa-miR-548k	CLIP-seq
MIRT1220366	hsa-miR-548l	CLIP-seq
MIRT1220367	hsa-miR-548n	CLIP-seq
MIRT1220368	hsa-miR-548t	CLIP-seq
MIRT1220369	hsa-miR-590-3p	CLIP-seq
MIRT1220370	hsa-miR-619	CLIP-seq
MIRT1220371	hsa-miR-664	CLIP-seq
MIRT1220372	hsa-miR-876-5p	CLIP-seq
MIRT1220373	hsa-miR-921	CLIP-seq
MIRT1220374	hsa-miR-922	CLIP-seq
MIRT1220375	hsa-miR-92a	CLIP-seq
MIRT1220376	hsa-miR-92b	CLIP-seq
MIRT1220377	hsa-miR-93	CLIP-seq
MIRT1552149	hsa-miR-1285	CLIP-seq
MIRT1552150	hsa-miR-3187-5p	CLIP-seq
MIRT1552151	hsa-miR-612	CLIP-seq
MIRT1220289	hsa-miR-1202	CLIP-seq
MIRT1220292	hsa-miR-1290	CLIP-seq
MIRT2063615	hsa-miR-141	CLIP-seq
MIRT2063616	hsa-miR-185	CLIP-seq
MIRT2063617	hsa-miR-200a	CLIP-seq
MIRT1220306	hsa-miR-25	CLIP-seq
MIRT2063618	hsa-miR-2964a-5p	CLIP-seq
MIRT1220311	hsa-miR-3167	CLIP-seq
MIRT1220313	hsa-miR-3194-5p	CLIP-seq
MIRT1220314	hsa-miR-32	CLIP-seq
MIRT1220320	hsa-miR-33a	CLIP-seq
MIRT1220321	hsa-miR-33b	CLIP-seq
MIRT1220324	hsa-miR-363	CLIP-seq
MIRT1220325	hsa-miR-367	CLIP-seq
MIRT2063619	hsa-miR-3942-3p	CLIP-seq
MIRT1220327	hsa-miR-3972	CLIP-seq
MIRT2063620	hsa-miR-4306	CLIP-seq
MIRT1220334	hsa-miR-4468	CLIP-seq
MIRT2063621	hsa-miR-4502	CLIP-seq
MIRT1220340	hsa-miR-4530	CLIP-seq
MIRT2063622	hsa-miR-4644	CLIP-seq
MIRT2063623	hsa-miR-4659a-5p	CLIP-seq
MIRT2063624	hsa-miR-4659b-5p	CLIP-seq
MIRT1220342	hsa-miR-4661-3p	CLIP-seq
MIRT1220344	hsa-miR-4693-3p	CLIP-seq
MIRT1220349	hsa-miR-4724-5p	CLIP-seq
MIRT2063625	hsa-miR-4762-3p	CLIP-seq
MIRT2063626	hsa-miR-4776-3p	CLIP-seq
MIRT1220370	hsa-miR-619	CLIP-seq
MIRT1220372	hsa-miR-876-5p	CLIP-seq
MIRT1220374	hsa-miR-922	CLIP-seq
MIRT1220375	hsa-miR-92a	CLIP-seq
MIRT1220376	hsa-miR-92b	CLIP-seq
MIRT2063627	hsa-miR-944	CLIP-seq
MIRT1220285	hsa-miR-103a	CLIP-seq
MIRT1220288	hsa-miR-107	CLIP-seq
MIRT1220289	hsa-miR-1202	CLIP-seq
MIRT2292090	hsa-miR-1208	CLIP-seq
MIRT1220294	hsa-miR-153	CLIP-seq
MIRT1220295	hsa-miR-15a	CLIP-seq
MIRT1220296	hsa-miR-15b	CLIP-seq
MIRT1220297	hsa-miR-16	CLIP-seq
MIRT1220299	hsa-miR-1912	CLIP-seq
MIRT1220301	hsa-miR-195	CLIP-seq
MIRT2292091	hsa-miR-19a	CLIP-seq
MIRT2292092	hsa-miR-19b	CLIP-seq
MIRT1220306	hsa-miR-25	CLIP-seq
MIRT1220310	hsa-miR-3130-5p	CLIP-seq
MIRT2292093	hsa-miR-3153	CLIP-seq
MIRT1220313	hsa-miR-3194-5p	CLIP-seq
MIRT1220314	hsa-miR-32	CLIP-seq
MIRT1220319	hsa-miR-330-3p	CLIP-seq
MIRT1220320	hsa-miR-33a	CLIP-seq
MIRT1220321	hsa-miR-33b	CLIP-seq
MIRT1220324	hsa-miR-363	CLIP-seq
MIRT1220325	hsa-miR-367	CLIP-seq
MIRT1220327	hsa-miR-3972	CLIP-seq
MIRT1220328	hsa-miR-3973	CLIP-seq
MIRT1220329	hsa-miR-424	CLIP-seq
MIRT1220330	hsa-miR-425	CLIP-seq
MIRT1220331	hsa-miR-4310	CLIP-seq
MIRT2292094	hsa-miR-4420	CLIP-seq
MIRT1220334	hsa-miR-4468	CLIP-seq
MIRT1220336	hsa-miR-4481	CLIP-seq
MIRT1220337	hsa-miR-4482	CLIP-seq
MIRT1220340	hsa-miR-4530	CLIP-seq
MIRT2292095	hsa-miR-4668-5p	CLIP-seq
MIRT1220344	hsa-miR-4693-3p	CLIP-seq
MIRT2292096	hsa-miR-4738-3p	CLIP-seq
MIRT1220351	hsa-miR-4745-5p	CLIP-seq
MIRT1220357	hsa-miR-497	CLIP-seq
MIRT1220364	hsa-miR-545	CLIP-seq
MIRT1220366	hsa-miR-548l	CLIP-seq
MIRT2292097	hsa-miR-892a	CLIP-seq
MIRT1220374	hsa-miR-922	CLIP-seq
MIRT1220375	hsa-miR-92a	CLIP-seq
MIRT1220376	hsa-miR-92b	CLIP-seq
MIRT2292091	hsa-miR-19a	CLIP-seq
MIRT2292092	hsa-miR-19b	CLIP-seq
MIRT2063618	hsa-miR-2964a-5p	CLIP-seq
MIRT2063621	hsa-miR-4502	CLIP-seq
MIRT2063625	hsa-miR-4762-3p	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0004114	Function	3',5'-cyclic-nucleotide phosphodiesterase activity	EXP	8562305, 9102399
GO:0004114	Function	3',5'-cyclic-nucleotide phosphodiesterase activity	IDA	14592490
GO:0004114	Function	3',5'-cyclic-nucleotide phosphodiesterase activity	IEA
GO:0004114	Function	3',5'-cyclic-nucleotide phosphodiesterase activity	TAS	17884339
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	IBA
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	IDA	14592490
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	IEA
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	TAS
GO:0005515	Function	Protein binding	IPI	17255105, 21393242, 32296183
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005794	Component	Golgi apparatus	ISS
GO:0005829	Component	Cytosol	TAS
GO:0007162	Process	Negative regulation of cell adhesion	IMP	17884339
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0008081	Function	Phosphoric diester hydrolase activity	IEA
GO:0008286	Process	Insulin receptor signaling pathway	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	18586889
GO:0016020	Component	Membrane	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IMP	21393242
GO:0016787	Function	Hydrolase activity	IEA
GO:0032045	Component	Guanyl-nucleotide exchange factor complex	IDA	17884339
GO:0033629	Process	Negative regulation of cell adhesion mediated by integrin	IC	17884339
GO:0043422	Function	Protein kinase B binding	ISS
GO:0045765	Process	Regulation of angiogenesis	IMP	21840392
GO:0046872	Function	Metal ion binding	IEA
GO:0047555	Function	3',5'-cyclic-GMP phosphodiesterase activity	IBA
GO:0047555	Function	3',5'-cyclic-GMP phosphodiesterase activity	IEA
GO:0050995	Process	Negative regulation of lipid catabolic process	IMP	11641262
GO:0051896	Process	Regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	21840392
GO:0106072	Process	Negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0106072	Process	Negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	TAS	17884339
GO:0141162	Process	Negative regulation of cAMP/PKA signal transduction	IBA

MIM	HGNC	e!Ensembl
602047	8779	ENSG00000152270

Q13370

Protein name

cGMP-inhibited 3',5'-cyclic phosphodiesterase 3B (EC 3.1.4.17) (CGIPDE1) (CGIP1) (Cyclic GMP-inhibited phosphodiesterase B) (CGI-PDE B)

Protein function

Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological process (PubMed:14592490, PubMed:21393242). Regulates angiogenesis by inhibiting the cA

PDB

1SO2 , 1SOJ , 8SYC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00233	PDEase_I	796 → 1008		Domain

Tissue specificity

TISSUE SPECIFICITY: Abundant in adipose tissues. {ECO:0000269|PubMed:8884271}.

Sequence

MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELR
PPPASPQQPRRCSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLS
PLFSIACAFFFLTCFLTRTKRGPGPGRSCGSWWLLALPACCYLGDFLVWQWWSWPWGDGD
AGSAAPHTPPEAAAGRLLLVLSCVGLLLTLAHPLRLRHCVLVLLLASFVWWVSFTSLGSL
PSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSSAAEEKVPVIRPRRRSSCVSL
GETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEAR
NMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKG
DRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGP
FNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDT
ADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSG
KSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVSLD
LILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQF
MNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTGNETDSDGRIN
HGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQ
AVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFD
FLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFY
EQGDEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDN
DTESGDDEDGEELDTEDEEMENNLNPKPPRRKSRRRIFCQLMHHLTENHKIWKEIVEEEE
KCKADGNKLQVENSSLPQADEIQVIEEADEEE

Sequence length

1112

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Metabolic pathways cGMP-PKG signaling pathway cAMP signaling pathway Apelin signaling pathway Insulin signaling pathway Progesterone-mediated oocyte maturation Glucagon signaling pathway Regulation of lipolysis in adipocytes Renin secretion Morphine addiction		PDE3B signalling G alpha (s) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITAMIN D HYDROXYLATION-DEFICIENT RICKETS, TYPE 1B	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITAMIN D-DEPENDENT RICKETS, TYPE 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (48)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenal Hyperplasia Congenital	Congenital adrenal hyperplasia	Pubtator	33112806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	27002827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30275531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11939588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30741720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	40462176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34875679	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	11839681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19033455, 19380787, 21120911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24282571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29691411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29691411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	29691411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	30275531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29691411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11640991, 12765845, 12965109, 30275531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial generalized lipodystrophy	Lipodystrophy	BEFREE	11640991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	16980375	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	30530703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	12965109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	33112806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	16980375	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	12965109, 17189322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	17389707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	17389707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	17389707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	17189322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoatrophic Diabetes Mellitus	Lipoatrophic Diabetes Mellitus	BEFREE	11640991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24133626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18462347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	23453122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	23453122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28084425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	12965109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24133626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	12965109, 24368730, 28084425		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	11939588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	25575966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	25575966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinoblastoma	Retinoblastoma	BEFREE	15480303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24133626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28275299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Striatal Degeneration, Autosomal Dominant	Striatal Degeneration	BEFREE	26769607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	34852423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	11939588		★★★★★ ★☆☆☆☆ Found in Text Mining only

PDE3B (phosphodiesterase 3B)