Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51397
Gene name	COMM domain containing 10
Gene symbol	COMMD10
Synonyms (NCBI Gene)	PTD002
Chromosome	5
Chromosome location	5q23.1

139

Show/Hide all (139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031600	hsa-miR-16-5p	Microarray	21199864
MIRT440913	ebv-miR-BART4-5p	HITS-CLIP	22473208
MIRT440913	ebv-miR-BART4-5p	HITS-CLIP	22473208
MIRT903306	hsa-miR-337-3p	CLIP-seq
MIRT903307	hsa-miR-3667-3p	CLIP-seq
MIRT903308	hsa-miR-3680	CLIP-seq
MIRT903309	hsa-miR-4671-5p	CLIP-seq
MIRT903310	hsa-miR-4795-3p	CLIP-seq
MIRT903311	hsa-miR-4798-3p	CLIP-seq
MIRT903312	hsa-miR-548p	CLIP-seq
MIRT903313	hsa-miR-656	CLIP-seq
MIRT1967822	hsa-miR-224	CLIP-seq
MIRT1967823	hsa-miR-323-3p	CLIP-seq
MIRT1967824	hsa-miR-4420	CLIP-seq
MIRT2203704	hsa-miR-1286	CLIP-seq
MIRT2203705	hsa-miR-205	CLIP-seq
MIRT2203706	hsa-miR-3128	CLIP-seq
MIRT2203707	hsa-miR-338-3p	CLIP-seq
MIRT2203708	hsa-miR-338-5p	CLIP-seq
MIRT903308	hsa-miR-3680	CLIP-seq
MIRT2203709	hsa-miR-425	CLIP-seq
MIRT2203710	hsa-miR-4436a	CLIP-seq
MIRT2203711	hsa-miR-4530	CLIP-seq
MIRT2203712	hsa-miR-4645-3p	CLIP-seq
MIRT2203713	hsa-miR-4742-5p	CLIP-seq
MIRT903311	hsa-miR-4798-3p	CLIP-seq
MIRT2203714	hsa-miR-490-3p	CLIP-seq
MIRT2203715	hsa-miR-500a	CLIP-seq
MIRT2203716	hsa-miR-548ac	CLIP-seq
MIRT2203717	hsa-miR-548ae	CLIP-seq
MIRT2203718	hsa-miR-548aj	CLIP-seq
MIRT2203719	hsa-miR-548am	CLIP-seq
MIRT2203720	hsa-miR-548d-3p	CLIP-seq
MIRT2203721	hsa-miR-548x	CLIP-seq
MIRT2203722	hsa-miR-548z	CLIP-seq
MIRT2203723	hsa-miR-570	CLIP-seq
MIRT2506721	hsa-miR-1207-5p	CLIP-seq
MIRT2506722	hsa-miR-1279	CLIP-seq
MIRT2203704	hsa-miR-1286	CLIP-seq
MIRT2506723	hsa-miR-132	CLIP-seq
MIRT2506724	hsa-miR-135a	CLIP-seq
MIRT2506725	hsa-miR-135b	CLIP-seq
MIRT2203705	hsa-miR-205	CLIP-seq
MIRT2506726	hsa-miR-212	CLIP-seq
MIRT2506727	hsa-miR-219-5p	CLIP-seq
MIRT2506728	hsa-miR-31	CLIP-seq
MIRT2203706	hsa-miR-3128	CLIP-seq
MIRT2506729	hsa-miR-3153	CLIP-seq
MIRT1967823	hsa-miR-323-3p	CLIP-seq
MIRT903306	hsa-miR-337-3p	CLIP-seq
MIRT2203707	hsa-miR-338-3p	CLIP-seq
MIRT2203708	hsa-miR-338-5p	CLIP-seq
MIRT903307	hsa-miR-3667-3p	CLIP-seq
MIRT2506730	hsa-miR-3671	CLIP-seq
MIRT903308	hsa-miR-3680	CLIP-seq
MIRT2506731	hsa-miR-4255	CLIP-seq
MIRT2506732	hsa-miR-4272	CLIP-seq
MIRT2506733	hsa-miR-4280	CLIP-seq
MIRT2203710	hsa-miR-4436a	CLIP-seq
MIRT2506734	hsa-miR-4445	CLIP-seq
MIRT2203711	hsa-miR-4530	CLIP-seq
MIRT2203712	hsa-miR-4645-3p	CLIP-seq
MIRT903309	hsa-miR-4671-5p	CLIP-seq
MIRT2506735	hsa-miR-4722-5p	CLIP-seq
MIRT2506736	hsa-miR-4736	CLIP-seq
MIRT2203713	hsa-miR-4742-5p	CLIP-seq
MIRT2506737	hsa-miR-4763-3p	CLIP-seq
MIRT2506738	hsa-miR-4775	CLIP-seq
MIRT2506739	hsa-miR-4782-3p	CLIP-seq
MIRT903310	hsa-miR-4795-3p	CLIP-seq
MIRT903311	hsa-miR-4798-3p	CLIP-seq
MIRT2203714	hsa-miR-490-3p	CLIP-seq
MIRT2203715	hsa-miR-500a	CLIP-seq
MIRT2506740	hsa-miR-508-3p	CLIP-seq
MIRT2203716	hsa-miR-548ac	CLIP-seq
MIRT2203717	hsa-miR-548ae	CLIP-seq
MIRT2203718	hsa-miR-548aj	CLIP-seq
MIRT2203719	hsa-miR-548am	CLIP-seq
MIRT2506741	hsa-miR-548c-3p	CLIP-seq
MIRT2203720	hsa-miR-548d-3p	CLIP-seq
MIRT903312	hsa-miR-548p	CLIP-seq
MIRT2203721	hsa-miR-548x	CLIP-seq
MIRT2203722	hsa-miR-548z	CLIP-seq
MIRT2506742	hsa-miR-568	CLIP-seq
MIRT2203723	hsa-miR-570	CLIP-seq
MIRT2506743	hsa-miR-584	CLIP-seq
MIRT2506744	hsa-miR-590-3p	CLIP-seq
MIRT2506745	hsa-miR-607	CLIP-seq
MIRT903313	hsa-miR-656	CLIP-seq
MIRT2506746	hsa-miR-664	CLIP-seq
MIRT2506721	hsa-miR-1207-5p	CLIP-seq
MIRT2506722	hsa-miR-1279	CLIP-seq
MIRT2203704	hsa-miR-1286	CLIP-seq
MIRT2506723	hsa-miR-132	CLIP-seq
MIRT2506724	hsa-miR-135a	CLIP-seq
MIRT2506725	hsa-miR-135b	CLIP-seq
MIRT2203705	hsa-miR-205	CLIP-seq
MIRT2506726	hsa-miR-212	CLIP-seq
MIRT2506727	hsa-miR-219-5p	CLIP-seq
MIRT2506728	hsa-miR-31	CLIP-seq
MIRT2203706	hsa-miR-3128	CLIP-seq
MIRT1967823	hsa-miR-323-3p	CLIP-seq
MIRT903306	hsa-miR-337-3p	CLIP-seq
MIRT2203707	hsa-miR-338-3p	CLIP-seq
MIRT2203708	hsa-miR-338-5p	CLIP-seq
MIRT903307	hsa-miR-3667-3p	CLIP-seq
MIRT2506730	hsa-miR-3671	CLIP-seq
MIRT903308	hsa-miR-3680	CLIP-seq
MIRT2506732	hsa-miR-4272	CLIP-seq
MIRT2506733	hsa-miR-4280	CLIP-seq
MIRT2203710	hsa-miR-4436a	CLIP-seq
MIRT2506734	hsa-miR-4445	CLIP-seq
MIRT2203711	hsa-miR-4530	CLIP-seq
MIRT2203712	hsa-miR-4645-3p	CLIP-seq
MIRT903309	hsa-miR-4671-5p	CLIP-seq
MIRT2506735	hsa-miR-4722-5p	CLIP-seq
MIRT2506736	hsa-miR-4736	CLIP-seq
MIRT2203713	hsa-miR-4742-5p	CLIP-seq
MIRT2506737	hsa-miR-4763-3p	CLIP-seq
MIRT2506739	hsa-miR-4782-3p	CLIP-seq
MIRT903310	hsa-miR-4795-3p	CLIP-seq
MIRT903311	hsa-miR-4798-3p	CLIP-seq
MIRT2203714	hsa-miR-490-3p	CLIP-seq
MIRT2203715	hsa-miR-500a	CLIP-seq
MIRT2506740	hsa-miR-508-3p	CLIP-seq
MIRT2203716	hsa-miR-548ac	CLIP-seq
MIRT2203717	hsa-miR-548ae	CLIP-seq
MIRT2203718	hsa-miR-548aj	CLIP-seq
MIRT2203719	hsa-miR-548am	CLIP-seq
MIRT2506741	hsa-miR-548c-3p	CLIP-seq
MIRT2203720	hsa-miR-548d-3p	CLIP-seq
MIRT903312	hsa-miR-548p	CLIP-seq
MIRT2203721	hsa-miR-548x	CLIP-seq
MIRT2203722	hsa-miR-548z	CLIP-seq
MIRT2506742	hsa-miR-568	CLIP-seq
MIRT2203723	hsa-miR-570	CLIP-seq
MIRT2506743	hsa-miR-584	CLIP-seq
MIRT2506745	hsa-miR-607	CLIP-seq
MIRT903313	hsa-miR-656	CLIP-seq

Show/Hide all (4)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15799966, 21778237, 23563313, 25355947, 26496610, 28514442, 32296183, 32814053, 33961781, 35271311, 37172566
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA

MIM	HGNC	e!Ensembl
616704	30201	ENSG00000145781

Q9Y6G5

Protein name

COMM domain-containing protein 10

Protein function

Scaffold protein in the commander complex that is essential for endosomal recycling of transmembrane cargos; the commander complex is composed of the CCC subcomplex and the retriever subcomplex (PubMed:37172566, PubMed:38459129). May modulate ac

PDB

8ESD , 8F2R , 8F2U , 8P0W

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07258	COMM_domain	131 → 202	COMM domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:15799966}.

Sequence

MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAA
FSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQET
VEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFS
HKELFDFYNKLETIQAQLDSLT

Sequence length

202

Interactions

View interactions

	Reactome
			Neddylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRANULOMATOSIS WITH POLYANGIITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthma	Asthma	BEFREE	24993907		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	24993907	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	31164008		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34047468	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34493238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24993907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30487795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28817833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30787448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30487795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30787448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	31388106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24993907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	31164008		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	36919165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	30787448		★★★★★ ★☆☆☆☆ Found in Text Mining only

COMMD10 (COMM domain containing 10)