Gene Gene information from NCBI Gene database.
Entrez ID 51393
Gene name Transient receptor potential cation channel subfamily V member 2
Gene symbol TRPV2
Synonyms (NCBI Gene)
VRLVRL-1VRL1
Chromosome 17
Chromosome location 17p11.2
Summary This gene encodes an ion channel that is activated by high temperatures above 52 degrees Celsius. The protein may be involved in transduction of high-temperature heat responses in sensory ganglia. It is thought that in other tissues the channel may be act
miRNA miRNA information provided by mirtarbase database.
206
miRTarBase ID miRNA Experiments Reference
MIRT707055 hsa-miR-202-5p HITS-CLIP 21572407
MIRT707054 hsa-miR-223-3p HITS-CLIP 21572407
MIRT707053 hsa-miR-4524b-3p HITS-CLIP 21572407
MIRT707052 hsa-miR-1245a HITS-CLIP 21572407
MIRT707051 hsa-miR-8079 HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0005216 Function Monoatomic ion channel activity IEA
GO:0005216 Function Monoatomic ion channel activity TAS 10201375
GO:0005261 Function Monoatomic cation channel activity IDA 10201375
GO:0005261 Function Monoatomic cation channel activity IEA
GO:0005262 Function Calcium channel activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606676 18082 ENSG00000187688
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y5S1
Protein name Transient receptor potential cation channel subfamily V member 2 (TrpV2) (Osm-9-like TRP channel 2) (OTRPC2) (Vanilloid receptor-like protein 1) (VRL-1)
Protein function Calcium-permeable, non-selective cation channel with an outward rectification. Seems to be regulated, at least in part, by IGF1, PDGF and neuropeptide head activator. May transduce physical stimuli in mast cells. Activated by temperatures higher
PDB 2F37
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 67 193 Ankyrin repeats (3 copies) Repeat
PF00520 Ion_trans 389 657 Ion transport protein Family
Sequence
MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNY
RKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCL
MKAVLNLKDGVNACILPLLQIDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVK
LLVENGANVHARA
CGRFFQKGQGTCFYFGELPLSLAACTKQWDVVSYLLENPHQPASLQA
TDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARLCPTVQLEDIRNLQDLTPLKL
AAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSLYDLASVDSCEENSVLEIIAF
HCKSPHRHRMVVLEPLNKLLQAKWDLLIPKFFLNFLCNLIYMFIFTAVAYHQPTLKKQAA
PHLKAEVGNSMLLTGHILILLGGIYLLVGQLWYFWRRHVFIWISFIDSYFEILFLFQALL
TVVSQVLCFLAIEWYLPLLVSALVLGWLNLLYYTRGFQHTGIYSVMIQKVILRDLLRFLL
IYLVFLFGFAVALVSLSQEAWRPEAPTGPNATESVQPMEGQEDEGNGAQYRGILEASLEL
FKFTIGMGELAFQEQLHFRGMVLLLLLAYVLLTYILLLNMLIALMSETVNSVATDSW
SIW
KLQKAISVLEMENGYWWCRKKQRAGVMLTVGTKPDGSPDERWCFRVEEVNWASWEQTLPT
LCEDPSGAGVPRTLENPVLASPPKEDEDGASEENYVPVQLLQSN
Sequence length 764
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  NOD-like receptor signaling pathway
Inflammatory mediator regulation of TRP channels
  TRP channels
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ENDOMETRIAL NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adult Acute Myeloblastic Leukemia Myeloblastic Leukemia BEFREE 25903924
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis BEFREE 25869297, 30851707
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial fibrillation Pubtator 28839241 Associate
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial fibrillation Pubtator 36513971 Stimulate
★☆☆☆☆
Found in Text Mining only
B-Cell Lymphomas B-Cell Lymphoma BEFREE 23862671
★☆☆☆☆
Found in Text Mining only
Bladder Neoplasm Bladder Neoplasm BEFREE 23741410
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 31547381 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Basal Cell Basal cell carcinoma Pubtator 31690728 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of bladder Bladder carcinoma BEFREE 23741410
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 35558077 Associate
★☆☆☆☆
Found in Text Mining only