WNT16 (Wnt family member 16)

Gene

• Entrez ID: 51384
• Gene name: Wnt family member 16
• Gene symbol: WNT16
• Synonyms (NCBI Gene): -
• Chromosome: 7
• Chromosome location: 7q31.31
• Summary: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025130	hsa-miR-181a-5p	Microarray	17612493
MIRT650766	hsa-miR-5584-5p	HITS-CLIP	23824327
MIRT650765	hsa-miR-200a-5p	HITS-CLIP	23824327
MIRT650764	hsa-miR-200b-5p	HITS-CLIP	23824327
MIRT650763	hsa-miR-494-3p	HITS-CLIP	23824327
MIRT650762	hsa-miR-4261	HITS-CLIP	23824327
MIRT650761	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT650760	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT650759	hsa-miR-6721-5p	HITS-CLIP	23824327
MIRT650758	hsa-miR-486-3p	HITS-CLIP	23824327
MIRT650757	hsa-miR-491-5p	HITS-CLIP	23824327
MIRT650756	hsa-miR-3151-5p	HITS-CLIP	23824327
MIRT650755	hsa-miR-4447	HITS-CLIP	23824327
MIRT650753	hsa-miR-4472	HITS-CLIP	23824327
MIRT650754	hsa-miR-6742-5p	HITS-CLIP	23824327
MIRT650752	hsa-miR-4477a	HITS-CLIP	23824327
MIRT650751	hsa-miR-6796-5p	HITS-CLIP	23824327
MIRT734469	hsa-miR-941	RNA-seq, Western blotting	32560314
MIRT650766	hsa-miR-5584-5p	HITS-CLIP	23824327
MIRT650765	hsa-miR-200a-5p	HITS-CLIP	23824327
MIRT650764	hsa-miR-200b-5p	HITS-CLIP	23824327
MIRT650763	hsa-miR-494-3p	HITS-CLIP	23824327
MIRT650762	hsa-miR-4261	HITS-CLIP	23824327
MIRT650761	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT650760	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT650759	hsa-miR-6721-5p	HITS-CLIP	23824327
MIRT650758	hsa-miR-486-3p	HITS-CLIP	23824327
MIRT650757	hsa-miR-491-5p	HITS-CLIP	23824327
MIRT650756	hsa-miR-3151-5p	HITS-CLIP	23824327
MIRT650755	hsa-miR-4447	HITS-CLIP	23824327
MIRT650753	hsa-miR-4472	HITS-CLIP	23824327
MIRT650754	hsa-miR-6742-5p	HITS-CLIP	23824327
MIRT650752	hsa-miR-4477a	HITS-CLIP	23824327
MIRT650751	hsa-miR-6796-5p	HITS-CLIP	23824327
MIRT1493613	hsa-miR-323-3p	CLIP-seq
MIRT1493614	hsa-miR-361-3p	CLIP-seq
MIRT1493615	hsa-miR-4436b-5p	CLIP-seq
MIRT1493616	hsa-miR-4474-5p	CLIP-seq
MIRT1493617	hsa-miR-4661-3p	CLIP-seq
MIRT1493618	hsa-miR-4803	CLIP-seq
MIRT1493619	hsa-miR-889	CLIP-seq
MIRT1493620	hsa-miR-181a	CLIP-seq
MIRT1493621	hsa-miR-181b	CLIP-seq
MIRT1493622	hsa-miR-181c	CLIP-seq
MIRT1493623	hsa-miR-181d	CLIP-seq
MIRT1493624	hsa-miR-3143	CLIP-seq
MIRT1493625	hsa-miR-3671	CLIP-seq
MIRT1493626	hsa-miR-4262	CLIP-seq
MIRT1493627	hsa-miR-543	CLIP-seq
MIRT1493628	hsa-miR-607	CLIP-seq
MIRT2148784	hsa-miR-145	CLIP-seq
MIRT2148785	hsa-miR-3180-5p	CLIP-seq
MIRT2148785	hsa-miR-3180-5p	CLIP-seq
MIRT2369178	hsa-miR-4272	CLIP-seq
MIRT2369179	hsa-miR-587	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003408	Process	Optic cup formation involved in camera-type eye development	ISS	16258938
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005109	Function	Frizzled binding	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10500199
GO:0005737	Component	Cytoplasm	IDA	17200136
GO:0010628	Process	Positive regulation of gene expression	IMP	16007226
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IMP	19951988
GO:0030182	Process	Neuron differentiation	IBA
GO:0030216	Process	Keratinocyte differentiation	IMP	17200136
GO:0043616	Process	Keratinocyte proliferation	IMP	17200136
GO:0045165	Process	Cell fate commitment	IBA
GO:0046330	Process	Positive regulation of JNK cascade	IMP	17200136
GO:0046849	Process	Bone remodeling	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	19951988
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060317	Process	Cardiac epithelial to mesenchymal transition	IEA
GO:0090399	Process	Replicative senescence	IMP	19951988
GO:0090403	Process	Oxidative stress-induced premature senescence	IMP	19951988
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IMP	17200136

Other IDs

• MIM: 606267
• HGNC: 16267
• e!Ensembl: ENSG00000002745

Protein

• UniProt ID: Q9UBV4
• Protein name: Protein Wnt-16
• Protein function: Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameter
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00110	wnt	49 → 365	wnt family	Family

• Tissue specificity: TISSUE SPECIFICITY: Isoform Wnt-16b is expressed in peripheral lymphoid organs such as spleen, appendix, and lymph nodes, in kidney but not in bone marrow. Isoform Wnt-16a is expressed at significant levels only in the pancreas.
• Sequence:

  MDRAALLGLARLCALWAALLVLFPYGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELC
  KRKPYLLPSIREGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKET
  AFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSR
  KFLDFPIGNTTGKENKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMS
  SFEKIGHLLKDKYENSIQISDKTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKL
  GIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTD
  VHTCK

• Sequence length: 365

Pathways

KEGG:

mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Cushing syndrome
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Reactome:

WNT ligand biogenesis and trafficking

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKLE FRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE FRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER EXTREMITY FRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	26254351		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26254351		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	35355568	Associate	★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	BEFREE	22792070		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26285063		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	34879876	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	37831088	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26285063		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24243566		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24243566	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	36463522	Stimulate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	26254351		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17148579		★☆☆☆☆ Found in Text Mining only
Coffin-Siris syndrome	Coffin-Siris Syndrome	BEFREE	23300646		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37090726	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19156209		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24096177, 27147711, 28766055, 30745310, 31560818		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32181818	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	35507738	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	GWASCAT_DG	30251476		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	32867823	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16769578		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31608065, 35283196	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31608065		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26285063		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28414916		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis III	Mucopolysaccharidosis	Pubtator	26458489	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26285063, 28414916		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	35355568, 40691153	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23300646	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31560818	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31560818	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	31560818	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29406783		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	24185276, 24430505, 26584014, 28013361, 29981832, 30026596, 30980960, 31309515, 31582989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	30026596, 30890710, 32827035, 37831088	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	10500199		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10500199		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	26254351		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	30251476		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	34879876	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26458489	Associate	★☆☆☆☆ Found in Text Mining only
Vitelliform Macular Dystrophy	Vitelliform Macular Dystrophy	BEFREE	22792070		★☆☆☆☆ Found in Text Mining only