Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51380
Gene name	Cysteine sulfinic acid decarboxylase
Gene symbol	CSAD
Synonyms (NCBI Gene)	CSDPCAP
Chromosome	12
Chromosome location	12q13.13
Summary	This gene encodes a member of the group 2 decarboxylase family. A similar protein in rodents plays a role in multiple biological processes as the rate-limiting enzyme in taurine biosynthesis, catalyzing the decarboxylation of cysteinesulfinate to hypotaur

117

Show/Hide all (117)

miRTarBase ID	miRNA	Experiments
MIRT911345	hsa-miR-106a	CLIP-seq
MIRT911346	hsa-miR-106b	CLIP-seq
MIRT911347	hsa-miR-122	CLIP-seq
MIRT911348	hsa-miR-1234	CLIP-seq
MIRT911349	hsa-miR-1245	CLIP-seq
MIRT911350	hsa-miR-1254	CLIP-seq
MIRT911351	hsa-miR-1307	CLIP-seq
MIRT911352	hsa-miR-150	CLIP-seq
MIRT911353	hsa-miR-17	CLIP-seq
MIRT911354	hsa-miR-1909	CLIP-seq
MIRT911355	hsa-miR-20a	CLIP-seq
MIRT911356	hsa-miR-20b	CLIP-seq
MIRT911357	hsa-miR-302a	CLIP-seq
MIRT911358	hsa-miR-302b	CLIP-seq
MIRT911359	hsa-miR-302c	CLIP-seq
MIRT911360	hsa-miR-302d	CLIP-seq
MIRT911361	hsa-miR-302e	CLIP-seq
MIRT911362	hsa-miR-3116	CLIP-seq
MIRT911363	hsa-miR-342-5p	CLIP-seq
MIRT911364	hsa-miR-3663-5p	CLIP-seq
MIRT911365	hsa-miR-372	CLIP-seq
MIRT911366	hsa-miR-373	CLIP-seq
MIRT911367	hsa-miR-4254	CLIP-seq
MIRT911368	hsa-miR-4423-5p	CLIP-seq
MIRT911369	hsa-miR-4438	CLIP-seq
MIRT911370	hsa-miR-4638-5p	CLIP-seq
MIRT911371	hsa-miR-4664-5p	CLIP-seq
MIRT911372	hsa-miR-4731-5p	CLIP-seq
MIRT911373	hsa-miR-5095	CLIP-seq
MIRT911374	hsa-miR-512-3p	CLIP-seq
MIRT911375	hsa-miR-519d	CLIP-seq
MIRT911376	hsa-miR-520a-3p	CLIP-seq
MIRT911377	hsa-miR-520b	CLIP-seq
MIRT911378	hsa-miR-520c-3p	CLIP-seq
MIRT911379	hsa-miR-520d-3p	CLIP-seq
MIRT911380	hsa-miR-520e	CLIP-seq
MIRT911381	hsa-miR-520g	CLIP-seq
MIRT911382	hsa-miR-520h	CLIP-seq
MIRT911383	hsa-miR-640	CLIP-seq
MIRT911384	hsa-miR-93	CLIP-seq
MIRT1970249	hsa-miR-1913	CLIP-seq
MIRT1970250	hsa-miR-3143	CLIP-seq
MIRT1970251	hsa-miR-324-3p	CLIP-seq
MIRT1970252	hsa-miR-331-3p	CLIP-seq
MIRT911364	hsa-miR-3663-5p	CLIP-seq
MIRT1970253	hsa-miR-411	CLIP-seq
MIRT1970254	hsa-miR-4292	CLIP-seq
MIRT1970255	hsa-miR-4313	CLIP-seq
MIRT911370	hsa-miR-4638-5p	CLIP-seq
MIRT1970256	hsa-miR-4659a-5p	CLIP-seq
MIRT1970257	hsa-miR-4659b-5p	CLIP-seq
MIRT1970258	hsa-miR-4772-3p	CLIP-seq
MIRT1970259	hsa-miR-4776-3p	CLIP-seq
MIRT1970260	hsa-miR-498	CLIP-seq
MIRT1970261	hsa-miR-543	CLIP-seq
MIRT1970262	hsa-miR-590-3p	CLIP-seq
MIRT2206165	hsa-miR-1208	CLIP-seq
MIRT911348	hsa-miR-1234	CLIP-seq
MIRT911349	hsa-miR-1245	CLIP-seq
MIRT911352	hsa-miR-150	CLIP-seq
MIRT2206166	hsa-miR-4318	CLIP-seq
MIRT911369	hsa-miR-4438	CLIP-seq
MIRT911373	hsa-miR-5095	CLIP-seq
MIRT911381	hsa-miR-520g	CLIP-seq
MIRT911382	hsa-miR-520h	CLIP-seq
MIRT2206167	hsa-miR-548c-3p	CLIP-seq
MIRT911383	hsa-miR-640	CLIP-seq
MIRT2206168	hsa-miR-663b	CLIP-seq
MIRT911351	hsa-miR-1307	CLIP-seq
MIRT2386494	hsa-miR-4284	CLIP-seq
MIRT911370	hsa-miR-4638-5p	CLIP-seq
MIRT1970258	hsa-miR-4772-3p	CLIP-seq
MIRT2447697	hsa-miR-3149	CLIP-seq
MIRT1970253	hsa-miR-411	CLIP-seq
MIRT2447698	hsa-miR-423-3p	CLIP-seq
MIRT911370	hsa-miR-4638-5p	CLIP-seq
MIRT2447699	hsa-miR-4735-5p	CLIP-seq
MIRT2447700	hsa-miR-4775	CLIP-seq
MIRT1970262	hsa-miR-590-3p	CLIP-seq
MIRT2447697	hsa-miR-3149	CLIP-seq
MIRT1970253	hsa-miR-411	CLIP-seq
MIRT2447698	hsa-miR-423-3p	CLIP-seq
MIRT911370	hsa-miR-4638-5p	CLIP-seq
MIRT2447699	hsa-miR-4735-5p	CLIP-seq
MIRT2447700	hsa-miR-4775	CLIP-seq
MIRT1970262	hsa-miR-590-3p	CLIP-seq
MIRT1970249	hsa-miR-1913	CLIP-seq
MIRT2509401	hsa-miR-1972	CLIP-seq
MIRT2447697	hsa-miR-3149	CLIP-seq
MIRT1970251	hsa-miR-324-3p	CLIP-seq
MIRT1970252	hsa-miR-331-3p	CLIP-seq
MIRT1970253	hsa-miR-411	CLIP-seq
MIRT2447698	hsa-miR-423-3p	CLIP-seq
MIRT1970254	hsa-miR-4292	CLIP-seq
MIRT1970255	hsa-miR-4313	CLIP-seq
MIRT911370	hsa-miR-4638-5p	CLIP-seq
MIRT2509402	hsa-miR-4717-5p	CLIP-seq
MIRT2509403	hsa-miR-4727-5p	CLIP-seq
MIRT2447699	hsa-miR-4735-5p	CLIP-seq
MIRT2447700	hsa-miR-4775	CLIP-seq
MIRT1970260	hsa-miR-498	CLIP-seq
MIRT1970262	hsa-miR-590-3p	CLIP-seq
MIRT1970249	hsa-miR-1913	CLIP-seq
MIRT2509401	hsa-miR-1972	CLIP-seq
MIRT2447697	hsa-miR-3149	CLIP-seq
MIRT1970251	hsa-miR-324-3p	CLIP-seq
MIRT1970252	hsa-miR-331-3p	CLIP-seq
MIRT1970253	hsa-miR-411	CLIP-seq
MIRT2447698	hsa-miR-423-3p	CLIP-seq
MIRT1970254	hsa-miR-4292	CLIP-seq
MIRT1970255	hsa-miR-4313	CLIP-seq
MIRT911370	hsa-miR-4638-5p	CLIP-seq
MIRT2509402	hsa-miR-4717-5p	CLIP-seq
MIRT2447699	hsa-miR-4735-5p	CLIP-seq
MIRT2447700	hsa-miR-4775	CLIP-seq
MIRT1970260	hsa-miR-498	CLIP-seq
MIRT1970262	hsa-miR-590-3p	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence
GO:0004068	Function	Aspartate 1-decarboxylase activity	IEA
GO:0004782	Function	Sulfinoalanine decarboxylase activity	IBA
GO:0004782	Function	Sulfinoalanine decarboxylase activity	IEA
GO:0004782	Function	Sulfinoalanine decarboxylase activity	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0016829	Function	Lyase activity	IEA
GO:0016830	Function	Carbon-carbon lyase activity	IEA
GO:0016831	Function	Carboxy-lyase activity	IEA
GO:0019449	Process	L-cysteine catabolic process to hypotaurine	IEA
GO:0019449	Process	L-cysteine catabolic process to hypotaurine	ISS
GO:0019452	Process	L-cysteine catabolic process to taurine	IEA
GO:0019452	Process	L-cysteine catabolic process to taurine	ISS
GO:0019752	Process	Carboxylic acid metabolic process	IEA
GO:0030170	Function	Pyridoxal phosphate binding	IEA
GO:0042412	Process	Taurine biosynthetic process	IBA
GO:0042412	Process	Taurine biosynthetic process	IEA
GO:0042412	Process	Taurine biosynthetic process	IEA
GO:0042412	Process	Taurine biosynthetic process	ISS

MIM	HGNC	e!Ensembl
616569	18966	ENSG00000139631

Q9Y600

Protein name

Cysteine sulfinic acid decarboxylase (EC 4.1.1.29) (Aspartate 1-decarboxylase) (EC 4.1.1.11) (Cysteine-sulfinate decarboxylase) (Sulfinoalanine decarboxylase)

Protein function

Catalyzes the decarboxylation of L-aspartate, 3-sulfino-L-alanine (cysteine sulfinic acid), and L-cysteate to beta-alanine, hypotaurine and taurine, respectively. The preferred substrate is 3-sulfino-L-alanine. Does not exhibit any decarboxylati

PDB

2JIS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00282	Pyridoxal_deC	49 → 417	Pyridoxal-dependent decarboxylase conserved domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in liver and brain. Also expressed in both astrocytes and neurons, but lower levels are expressed in astrocytes. {ECO:0000269|PubMed:26327310}.

Sequence

MADSEALPSLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLEL
RSQGESQKQILERCRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEI
APVFVLMEEEVLRKLRALVGWSSGDGIFCPGGSISNMYAVNLARYQRYPDCKQRGLRTLP
PLALFTSKECHYSIQKGAAFLGLGTDSVRVVKADERGKMVPEDLERQIGMAEAEGAVPFL
VSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQTHRHLLDGIQRADSVA
WNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRV
DCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPS
LRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMD
FLLNELERLGQDL

Sequence length

493

Interactions

View interactions

	KEGG
	beta-Alanine metabolism Taurine and hypotaurine metabolism Pantothenate and CoA biosynthesis Metabolic pathways

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (36)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	31571874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	27573188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30757948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	21627373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	12949798, 21627373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17145810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31943856, 38025761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Coordination Disorder	Developmental dyspraxia	BEFREE	30552074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30552108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29258994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Hemiplegic Migraine	Hemiplegic Migraine	BEFREE	15003166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28957313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28957313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemiplegic migraine, familial type 1	Hemiplegic migraine	BEFREE	17395138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	11254448, 11507049, 11522646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10986046, 11254448, 11254449, 11379880, 11431329, 11507049, 11522646, 11673416, 11751379, 12373607, 12522685, 12552947, 12783937, 12949798, 14504198 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27452673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	30704353		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16809487, 18368129, 21788131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	17395138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	17395138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22068284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17145810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	29984162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28529640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	10677314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	11254448, 11522646, 11751379, 12949798, 15368467, 18767027, 23141781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10986046, 11254448, 11254449, 11379880, 11431329, 11507049, 11522646, 11673416, 11751379, 12373607, 12522685, 12552947, 12783937, 14504198, 14625808 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	14625808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	14735201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	18203815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	18203815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	30603903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28529640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	18203815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Visual auras	Visual auras	BEFREE	30291554		★★★★★ ★☆☆☆☆ Found in Text Mining only

CSAD (cysteine sulfinic acid decarboxylase)